DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and yip7

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:297 Identity:82/297 - (27%)
Similarity:122/297 - (41%) Gaps:52/297 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VQVCCPSTAGLGAL-----THP----LLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEK 133
            |.|...::|..|.|     .||    ..||..|::    :|..|....:||:...:.::  :...
  Fly     6 VLVLALASASAGLLPNIAPVHPRDRVSTPSITGRI----TNGKDAVAGQFPYQVGLSFS--SSAG 64

  Fly   134 IHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDI 198
            ...|||.:|.:.:|||||||...||:..:...|.      ..|:|:..              |.:
  Fly    65 SWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGAT------VRTSPEFT--------------QVV 109

  Fly   199 AIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQAS 263
            :..:...|..|  ...|..|||:|::.:| ...:..|..|.||.........|......:||..:
  Fly   110 SSSKFRQHESY--LALTIRNDISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLT 171

  Fly   264 SSQRMRKG----YV--TISSIEECQRKYASQQLRIQASKLC-GLTN-SQECYGNAGGPLMLFKND 320
            |.|.....    ||  ||.|..:||..:.|  |.:.:..|| ..|| :..|.|::||||.|   |
  Fly   172 SDQATAVSRDLQYVDLTIISNSKCQETFGS--LIVTSRVLCVDTTNKASTCQGDSGGPLAL---D 231

  Fly   321 GYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDS 357
            |.|:|. .|||.........|..:||:..|.|||.::
  Fly   232 GVLIGA-TSFGSADGCESGAPAAFTRITYYRDWIKET 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 2/3 (67%)
Tryp_SPc 111..356 CDD:238113 71/252 (28%)
Tryp_SPc 111..354 CDD:214473 69/250 (28%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 70/259 (27%)
Tryp_SPc 40..267 CDD:238113 72/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.