DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG15873

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:339 Identity:78/339 - (23%)
Similarity:122/339 - (35%) Gaps:111/339 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FMRILLSGNLSQSDRNLLRDNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDT 113
            |:.::||.:||.:|..::.|                   :...|..:|.|...|.:..|.:....
  Fly     7 FLGLILSTSLSDADLGVIGD-------------------ISDETFEMLISGGYKPKSNRLSRHVV 52

  Fly   114 RIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAV--------RLG 170
            .||      ...|.|...:. |.|.|||:|.|.|||||||:.....:::....:        ||.
  Fly    53 SIR------TKNYVRHRGDN-HFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLA 110

  Fly   171 EWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAK-LNDF 234
            .:|.|         |.:           :::.|:.||.|.|..:   ||:|::||:...: .|..
  Fly   111 VYDES---------DFR-----------SVDRLVVHPEYERYKK---NDLAILRLSERVQSSNHD 152

  Fly   235 VQPICLPNKQLRADELEDLVTEVAGW-----QASSSQRMRKGYVTISSIEECQRKY----ASQQL 290
            |.|: |..|.......:..:|  .||     ....|..:....|.:.....||:.|    |...:
  Fly   153 VLPL-LMRKTANVTYGDTCIT--LGWGQIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNV 214

  Fly   291 RIQASKLCGLTNSQECYGNAGGPLM----LFKNDGYLLGG-----------LVSFGPVPCPNPDW 340
            ..:.     :..|..|.|:.||||:    ||.    |:||           .:||          
  Fly   215 CTEP-----VGESMNCAGDMGGPLLCKGALFG----LIGGHMGCAGGKAMKFLSF---------- 260

  Fly   341 PDVYTRVASYIDWI 354
              :|     |.|||
  Fly   261 --LY-----YKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 7/32 (22%)
Tryp_SPc 111..356 CDD:238113 66/277 (24%)
Tryp_SPc 111..354 CDD:214473 64/275 (23%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 62/255 (24%)
Tryp_SPc 59..250 CDD:238113 57/226 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.