DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG30283

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:301 Identity:82/301 - (27%)
Similarity:131/301 - (43%) Gaps:62/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VQVCCPSTAGLGALTHPLLPSDCGKV---RWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGG 139
            |.:...|...||:.:...|...||.|   :::.....:..:...||:|::....|    .| |||
  Fly    11 VLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGG----FH-CGG 70

  Fly   140 VLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELL 204
            .||::|:|||:|||:|.....      ||||                 |.:.....|..|::.:.
  Fly    71 TLITNRFVLTSAHCIANGELK------VRLG-----------------VLEREAEAQKFAVDAMF 112

  Fly   205 PHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVT-EVAGW----QASS 264
            .|..|....    :|:||:|||.....:|.:.||||....|..:..|.:|. ...||    ..||
  Fly   113 VHTDYYFDQ----HDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSS 173

  Fly   265 SQRMRKGYVTISSIEECQRKYASQQLRIQASKLCG-LTNSQECYGNAGGPL----------MLFK 318
            |:.::|..:......||.::|..||  |..:.:|. ..|:..|.|::||||          |:|:
  Fly   174 SRMLQKTSLFNLHRSECAKQYPHQQ--INRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQ 236

  Fly   319 NDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSLK 359
                  .|:.|||...|..   ..|:|.|.:::|||.::::
  Fly   237 ------FGVTSFGHADCSK---ATVFTNVMTHLDWIVNTVR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 1/3 (33%)
Tryp_SPc 111..356 CDD:238113 74/260 (28%)
Tryp_SPc 111..354 CDD:214473 72/258 (28%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 72/263 (27%)
Tryp_SPc 43..266 CDD:238113 74/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.