DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG12133

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:336 Identity:101/336 - (30%)
Similarity:155/336 - (46%) Gaps:50/336 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MRILLSGNLSQSDRNLLRDNQCGVRG------NDVQVCCPSTAGLGALTHPLLPSD--CGKVRWQ 106
            |:||...|::...::..|:..|.:..      :.|..|||..||      ..||..  ||     
  Fly     1 MKILHPRNMTNDQKSQYRNKLCNINPFAHELVHMVFTCCPMVAG------DKLPDSRVCG----- 54

  Fly   107 RS-------NDTDTRIREFPWLALIEYT--RGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNL 162
            :|       ...:.:..:|||..|:.|.  ...|.....|.|.||:.|||||||||:   ..::.
  Fly    55 QSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCL---NVNDF 116

  Fly   163 QITAVRLGEWDTSTNPDCQY-HEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLA 226
            .:..|||||.||..:||..: ...:|:  .||.:.||.::..:||..|...:....|||||:||.
  Fly   117 YVARVRLGEHDTENDPDYTWLPNGAKI--WAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLK 179

  Fly   227 SPAKLNDFVQPICL-PNKQLRADELEDLVTEVAGWQASSSQR----MRKGYVTISSIEECQRKY- 285
            |..|....::|||: |..:|.....::...::|||..|..|:    :|:|.::..|.:||..:| 
  Fly   180 SRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYP 244

  Fly   286 ---ASQQLRIQASKLCGLTNSQECYGNAGGPLMLFKNDG----YLLGGLVSFGPVPCPNPDWPDV 343
               ..:.::|.|   .|...:....|::|.|||.....|    |.|.|:.|:|..|......|.|
  Fly   245 TLLVDKDIQICA---MGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAV 306

  Fly   344 YTRVASYIDWI 354
            ||:.:||.:||
  Fly   307 YTKTSSYYEWI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 7/37 (19%)
Tryp_SPc 111..356 CDD:238113 84/260 (32%)
Tryp_SPc 111..354 CDD:214473 82/258 (32%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 84/264 (32%)
Tryp_SPc 62..317 CDD:214473 82/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463204
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D85090at50557
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.