DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and Jon44E

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:302 Identity:76/302 - (25%)
Similarity:125/302 - (41%) Gaps:64/302 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VQVCCPSTAGLGALTHPLLPSD------------CGKVRWQRSNDTDTRIREFPWLALIEYTRGN 130
            |.:.|.:.|..|     ::||:            .||:..:.:|.......:.|::..:.:..|.
  Fly     5 VFLACLAVASAG-----VVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGG 64

  Fly   131 QEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQY-HEDSKVADCAPP 194
                :.|||.:|...:|||||||     |::.....:..|   .|...:.|| |..|:       
  Fly    65 ----YWCGGSIIDHTWVLTAAHC-----TNSANHVLIYFG---ASFRHEAQYTHWVSR------- 110

  Fly   195 YQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDF---VQPICLPNKQLRADELEDLVTE 256
                  .:::.||.:|  |... |||||:|:...    ||   |..:.||:...|.:........
  Fly   111 ------SDMIQHPDWN--DFLN-NDIALIRIPHV----DFWSLVNKVELPSYNDRYNSYSGWWAV 162

  Fly   257 VAGWQASSSQRMRKGYVTISSIE-----ECQRKYASQQLRIQASKLCGLTN--SQECYGNAGGPL 314
            .:||..:.:......|:....::     :|:..|.|..  |..:.:|..|:  ...|.|::||||
  Fly   163 ASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNY--ITDNTICINTDGGKSSCSGDSGGPL 225

  Fly   315 MLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHD 356
            :|..|:..:  |:||||.........|..:|||..|:|||.|
  Fly   226 VLHDNNRIV--GIVSFGSGEGCTAGRPAGFTRVTGYLDWIRD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 1/3 (33%)
Tryp_SPc 111..356 CDD:238113 66/255 (26%)
Tryp_SPc 111..354 CDD:214473 64/253 (25%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 65/258 (25%)
Tryp_SPc 41..266 CDD:238113 68/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.