DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG4650

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:308 Identity:72/308 - (23%)
Similarity:128/308 - (41%) Gaps:95/308 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQE 132
            |.:||:..|                        ||:    :|:..:     ||:|.:.    ..|
  Fly    25 DGRCGLLTN------------------------GKI----ANNISS-----PWMAYLH----TSE 52

  Fly   133 KIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQD 197
            .::.|||.:|:::.|||||||    ..::.|:.| |:||:..:.:.:     |:.:::    || 
  Fly    53 LLYVCGGTVITEKLVLTAAHC----TRASEQLVA-RIGEFIGTDDAN-----DTMLSE----YQ- 102

  Fly   198 IAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDL-VTEVAGWQ 261
              :.:...|.|||.|  |..||||::.||:....:..::|||:....:....:::: |...|.|.
  Fly   103 --VSQTFIHSLYNTT--TSANDIAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWG 163

  Fly   262 ASSSQRMRKGY-VTISSIEECQRKYASQQLRIQASKLCGLTN------SQECYGNAG-------- 311
            ..:.:.....: :|              .:|.|.:.:|...|      ||.|.|::.        
  Fly   164 LPNDRNESDAFRIT--------------DIRRQPANMCSTLNGTAILSSQFCAGDSDSKLCNVDF 214

  Fly   312 ----GPLMLFKN-DGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354
                |.::.||| ..|:|.|:.:... .|..   ..|||.|.|:.|:|
  Fly   215 SSPLGAIITFKNIQRYVLIGIATTNQ-KCKR---ASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 4/13 (31%)
Tryp_SPc 111..356 CDD:238113 65/265 (25%)
Tryp_SPc 111..354 CDD:214473 64/263 (24%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 68/298 (23%)
Tryp_SPc 33..258 CDD:304450 68/298 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.