DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:238 Identity:66/238 - (27%)
Similarity:94/238 - (39%) Gaps:56/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 CGGVLISDRYVLTAAHCVAQAATSNLQITAV-RLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAI 200
            |||.:|...:|:|||||...|.:..:...|: ||....|.|.....:.:                
  Fly    71 CGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQAQYTHTVGSGHFRQ---------------- 119

  Fly   201 EELLPHPLYNRTDRTQINDIALVRLASPAKLNDF---VQPICLPNKQLRADELEDLVTEVAGWQA 262
                 |..||..:..  |||:|:.....    ||   :..:.||:...|.|..       |||.|
  Fly   120 -----HSDYNTNNLN--NDISLINTPHV----DFWHLINKVELPDGNERHDSF-------AGWWA 166

  Fly   263 SSSQRMR-------KGYVT-----ISSIEECQRKYASQQLRIQASKLCGLT--NSQECYGNAGGP 313
            .:|...|       ..|:.     |.:.:||...|.:..  |..:.:|..|  ....|.|::|||
  Fly   167 LASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDV--ITDNVICTSTPGGKSTCAGDSGGP 229

  Fly   314 LMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHD 356
            |:|  :|...|.|:.||..........||.:|||.||:|||.|
  Fly   230 LVL--HDRSKLVGVTSFVAASGCTSGLPDGFTRVTSYLDWIRD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 65/236 (28%)
Tryp_SPc 111..354 CDD:214473 63/234 (27%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 63/234 (27%)
Tryp_SPc 43..271 CDD:238113 66/238 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.