DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and Hayan

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:257 Identity:83/257 - (32%)
Similarity:130/257 - (50%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 FPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCV-AQAATSNLQITAVRLGEWDTSTNPDCQ 181
            :|.:|.|.|......... |||.||:.|:|||||||| :..:|.:.    ||||..:.. ||:  
  Fly   396 YPHMAAIAYNSFGSAAFR-CGGSLIASRFVLTAAHCVNSDDSTPSF----VRLGALNIE-NPE-- 452

  Fly   182 YHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLR 246
                       |.||||.:.::..||.|:.:  ::..|||:::||..||.:|.::|.||...  |
  Fly   453 -----------PGYQDINVIDVQIHPDYSGS--SKYYDIAILQLAEDAKESDVIRPACLYTD--R 502

  Fly   247 ADELEDLVTEVAGW------QASSSQRMRKGYVTISSIEECQRKYASQ-----QLR--IQASKLC 298
            :|...:....||||      ..:.|:.:.:..:.:...:||...:|.|     .||  :.||:||
  Fly   503 SDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLC 567

  Fly   299 GLTNSQE---CYGNAGGPLMLFKND---GYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354
            ....:|.   |.|::||||:|..:|   .|.:.|::|.| ..|.... |.:||||:|::|:|
  Fly   568 AADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSG-FGCATKT-PGLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 83/257 (32%)
Tryp_SPc 111..354 CDD:214473 82/255 (32%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 82/255 (32%)
Tryp_SPc 385..630 CDD:238113 83/257 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.