DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG31269

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:229 Identity:67/229 - (29%)
Similarity:111/229 - (48%) Gaps:40/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 HACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIA 199
            |:|||.:|::.:||||||||..|....|.:.        |.||   :|::         |.....
  Fly    62 HSCGGAIINETFVLTAAHCVENAFIPWLVVV--------TGTN---KYNQ---------PGGRYF 106

  Fly   200 IEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQA-- 262
            ::.:..|..|:..:  ..|||||:.|..|...::..|||.||...::..: |.::|   ||.:  
  Fly   107 LKAIHIHCNYDNPE--MHNDIALLELVEPIAWDERTQPIPLPLVPMQPGD-EVILT---GWGSTV 165

  Fly   263 ---SSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTNSQE--CYGNAGGPLMLFKNDGY 322
               :|...::..|:......||:...::.: ......:|..:...|  |:|::||||:   ::||
  Fly   166 LWGTSPIDLQVLYLQYVPHRECKALLSNDE-DCDVGHICTFSRLGEGACHGDSGGPLV---SNGY 226

  Fly   323 LLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHD 356
            |: |||::| .||.. ..|||:..|..|.|||.:
  Fly   227 LV-GLVNWG-WPCAT-GVPDVHASVYFYRDWIRN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 67/227 (30%)
Tryp_SPc 111..354 CDD:214473 65/225 (29%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/225 (29%)
Tryp_SPc 38..258 CDD:238113 67/229 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.