DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and sphinx1

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:255 Identity:49/255 - (19%)
Similarity:91/255 - (35%) Gaps:68/255 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 WLALIEYTRGNQEKIHACGGVLISDRYVLTA----------AHCVAQAATSNLQITAVRLGEWDT 174
            :|..|.|.:.....::...|.:||::::||.          .|..::.:.....|..:      .
  Fly    39 YLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRI------Y 97

  Fly   175 STNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPIC 239
            ..|....|..|..:|....|||...          .|.||.::                      
  Fly    98 KENFRFHYDNDHVIALVKCPYQKFD----------RRMDRVRV---------------------- 130

  Fly   240 LPNKQLRADELEDLVTEVAGW-----QASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLCG 299
             |....|.:.....:|.|.|:     .|...:.||...|.:.:..||.:.|..    ::..::| 
  Fly   131 -PAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTP----LKWYEMC- 189

  Fly   300 LTNSQ----ECYGNAGGPLM-LFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354
             |:.:    .|.|:.||.:: :..|..::  |::...|..| :..:|.|:.||:.:|.||
  Fly   190 -TSGEGFKGVCEGDIGGAVVTMGPNPTFI--GIIWLMPENC-SIGYPSVHIRVSDHIKWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 49/255 (19%)
Tryp_SPc 111..354 CDD:214473 47/253 (19%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 47/253 (19%)
Tryp_SPc 26..248 CDD:304450 49/255 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.