DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG18636

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:322 Identity:81/322 - (25%)
Similarity:132/322 - (40%) Gaps:70/322 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FMRILLSGNLSQSDRNLLRDNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDT 113
            |:.|:|...|..|..:...|..||:|..                        .:..::..|....
  Fly    11 FVGIILMFQLLHSGCSQFLDPACGIRTQ------------------------SRTAYRIINGHTA 51

  Fly   114 RIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNP 178
            :....||:..:..|    ..:..|||.||:|:.|||||||.    .:|..:.| ||||::.:.:.
  Fly    52 KYNSSPWMVFLHST----TDMFVCGGSLITDKLVLTAAHCF----IANQHLVA-RLGEYERTRSE 107

  Fly   179 D-----CQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPI 238
            :     |.:.|:..|        |...:    |.||:  ..|..||||::||:......|.::||
  Fly   108 ECTGYYCNFREEHMV--------DAGFK----HKLYD--PNTHANDIAILRLSKSVVYRDNIRPI 158

  Fly   239 CLPNKQLRADELE--DLVTEVAGW----QASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKL 297
            |:.........|:  ||:| ..||    ..|.|..::...:.....:.| .|:..|  .|..::.
  Fly   159 CVVWDHRWRHYLDKIDLLT-ATGWGKTQMESDSDALQTLDIRRQPPDVC-AKFIGQ--TIAGNQF 219

  Fly   298 C-GLTNSQECYGNAGGPL---MLFKN-DGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354
            | |..:|..|.|::||||   :..|| ..::..|:.|:....|..   ..|:|.|.|:.::|
  Fly   220 CAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK---ASVFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 9/32 (28%)
Tryp_SPc 111..356 CDD:238113 71/260 (27%)
Tryp_SPc 111..354 CDD:214473 70/258 (27%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/263 (27%)
Tryp_SPc 45..278 CDD:238113 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.