DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG33462

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:128/272 - (47%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAAT 159
            ||..|||..........:.::.:.||:|.:|..:|    .| |.|.||:..:||||||||    .
  Fly    24 LLEEDCGIPHNISERSVNAKLAQNPWMAYLETPKG----FH-CSGTLINHLFVLTAAHCV----P 79

  Fly   160 SNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVR 224
            .:|.|| |||||::|.|..||..|.      |..|:|:..::....|..||..|:|  |||.::|
  Fly    80 DDLLIT-VRLGEYNTKTKVDCDNHL------CQEPFQEYNVDMGFRHRYYNANDQT--NDIGMLR 135

  Fly   225 LASPAKLNDFVQPICL--PNK-QLRADELEDLVTEVAGWQASSSQRMRKGYVTIS----SIEECQ 282
            |....:..:.::|||:  .|: |...|:|....|.|  |:.:::....|...|::    ..|.|.
  Fly   136 LGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTV--WRETAANATSKVLRTMNIDRQPKETCS 198

  Fly   283 RKYASQQLRIQASKLC-GLTNSQECYGNAGGPLM--LFKN--DGYLLGGLVSFGPVPCPNPDWPD 342
            ..|.   ..:...::| |.|.||.|..::|.|.:  ::.|  |.|:..|:.|.....|.|   ..
  Fly   199 EIYG---WNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQN---SG 257

  Fly   343 VYTRVASYIDWI 354
            :...:.||.|||
  Fly   258 ILMDLLSYADWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 79/256 (31%)
Tryp_SPc 111..354 CDD:214473 77/254 (30%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 79/248 (32%)
Tryp_SPc 48..269 CDD:214473 77/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.