DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG33461

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:285 Identity:70/285 - (24%)
Similarity:128/285 - (44%) Gaps:42/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GLGALTHPLLPSDCG---KVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVL 148
            |:...:...|..:||   ::.::..|.|..|:..:||:|.:     :......|.|.||:..:||
  Fly    19 GVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFL-----HTPTYFLCAGSLINQWFVL 78

  Fly   149 TAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTD 213
            |:|||:    ..::::.| ||||.:...:.||:.:.      |....|:..::.|..|.||:..|
  Fly    79 TSAHCI----EDDVELIA-RLGENNRDNDIDCENNR------CLEATQEYNVDMLFKHRLYDPKD 132

  Fly   214 RTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVT--EVAGWQASSSQRMRKGYVTIS 276
            .:  |||.::||....:....:||||:.:.: |...:.|.:|  :..||..:|:....|....:.
  Fly   133 FS--NDIGMLRLERRVEYTYHIQPICIFHHR-RMQLVVDQITWFKATGWGLTSTDLNTKSSRVLM 194

  Fly   277 SI-------EECQRKYASQQLRIQASKLC-GLTNSQECYGNAGGP----LMLFKNDGYLLGGLVS 329
            .:       .:|.|.:....|   :.::| |..:...|.|::|||    :::|....::..|:.|
  Fly   195 ELNLYRRPRNDCARIFKQNFL---SGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIAS 256

  Fly   330 FGPVPCPNPDWPDVYTRVASYIDWI 354
            |....|..   ..:.|.|..|..||
  Fly   257 FTYENCSK---VSILTDVVRYGRWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 65/258 (25%)
Tryp_SPc 111..354 CDD:214473 63/256 (25%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 64/261 (25%)
Tryp_SPc 42..281 CDD:238113 66/262 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.