DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and Sp212

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:252 Identity:69/252 - (27%)
Similarity:110/252 - (43%) Gaps:31/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQ 181
            ::|||:.: |.:..:.....|.|.|||...|::|||||.:.....:   .|.||.:|..     .
  Fly   287 QYPWLSAV-YHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRV---VVGLGRYDLD-----D 342

  Fly   182 YHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLR 246
            |.||..        :...:..||.||.||....:.. ||||:.:..|...||.:.|||:  ..:.
  Fly   343 YGEDGA--------EMRNVMRLLWHPDYNTRSYSDA-DIALITIERPVTFNDIIAPICM--WTVE 396

  Fly   247 ADELEDLVTEVAGW----QASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLC--GLTNSQE 305
            |.........:|||    .:|.:|..|.....|:|...|...:....  :....||  ....|..
  Fly   397 ASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTM--VTERSLCAGNRDGSGP 459

  Fly   306 CYGNAGGPLMLFKNDGYLLGGLVSF---GPVPCPNPDWPDVYTRVASYIDWIHDSLK 359
            |.|::||.||:.:.|.:||.|:||.   ||......:...:|..::.:|:||.::::
  Fly   460 CVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENIR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 69/247 (28%)
Tryp_SPc 111..354 CDD:214473 67/245 (27%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 69/248 (28%)
Tryp_SPc 277..511 CDD:214473 67/245 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.