DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and F9

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:396 Identity:88/396 - (22%)
Similarity:141/396 - (35%) Gaps:121/396 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LSGNLSQSD--------------RNLLRDNQCGVRGN----------DVQVCCPSTAGLGAL--- 91
            |:|.:.:.|              ||...|..|.::..          |.::.|..|.|....   
  Rat    96 LNGGICKDDINSYECWCQAGFEGRNCELDATCSIKNGRCKQFCKNSPDNKIICSCTEGYQLAEDQ 160

  Fly    92 --THPLLPSDCGKV-----------------RWQRSNDTD------------------------- 112
              ..|.:|..||:|                 .....|.|:                         
  Rat   161 KSCEPAVPFPCGRVSVAYNSKKITRAETVFSNTDYGNSTELILDDITNSTILDNLTENSEPINDF 225

  Fly   113 TRI--------REFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRL 169
            ||:        .:.||..::     |.|....|||.:|::::::|||||:...  ..:::.|   
  Rat   226 TRVVGGENAKPGQIPWQVIL-----NGEIEAFCGGAIINEKWIVTAAHCLKPG--DKIEVVA--- 280

  Fly   170 GEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDF 234
            ||.:.....|.:...:              :...:||..||.|.....:||||:.|..|..||.:
  Rat   281 GEHNIDEKEDTEQRRN--------------VIRTIPHHQYNATINKYSHDIALLELDKPLILNSY 331

  Fly   235 VQPICLPNKQLRADELEDLVTEVAGW--------QASSSQRMRKGYVTISSIEECQRKYASQQLR 291
            |.|||:.||:.....|:.....|:||        |||..|.:|   |.:.....|.|   |.:..
  Rat   332 VTPICVANKEYTNIFLKFGSGYVSGWGKVFNKGRQASILQYLR---VPLVDRATCLR---STKFS 390

  Fly   292 IQASKLCG---LTNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDW 353
            |..:..|.   ......|.|::|||.:........|.|::|:|. .|.......:||:|:.|::|
  Rat   391 IYNNMFCAGYREGGKDSCEGDSGGPHVTEVEGTSFLTGIISWGE-ECAMKGKYGIYTKVSRYVNW 454

  Fly   354 IHDSLK 359
            |.:..|
  Rat   455 IKEKTK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 8/51 (16%)
Tryp_SPc 111..356 CDD:238113 70/288 (24%)
Tryp_SPc 111..354 CDD:214473 68/286 (24%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011 5/25 (20%)
FXa_inhibition 127..163 CDD:291342 5/35 (14%)
Tryp_SPc 227..455 CDD:214473 66/258 (26%)
Tryp_SPc 228..458 CDD:238113 67/260 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.