DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG30187

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:262 Identity:70/262 - (26%)
Similarity:112/262 - (42%) Gaps:77/262 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 WLALIEYTRGNQEKIH-ACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYH 183
            |:|.:      ..:.| .|||.||..|:|||||||:.     :..:.:|.||.::.|...|   .
  Fly    49 WMAAV------HNRTHFICGGTLIHKRFVLTAAHCIV-----DQDVQSVSLGAYNKSDPAD---R 99

  Fly   184 EDSKVA------DCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPN 242
            :|...|      |....|:                     |||.|::|:|....|..::|||:..
  Fly   100 KDVITAVVHSSFDVRASYE---------------------NDIGLLKLSSDVIFNALIRPICIVL 143

  Fly   243 KQLRADELEDLVT-EVAGWQASSSQRMRKGYVTISSI-------EECQRK---YASQQLRIQASK 296
            .:..|:.:.::.| :..||   .:.|..|....:.:|       |||..:   |.|::      :
  Fly   144 NKSMANHMRNMRTFKAFGW---GTLRGNKTSDILQTIILNHLDREECYMELSVYPSEK------Q 199

  Fly   297 LC-GLTNSQECYGNAGGPLMLFKNDGYLLG--------GLVSFGPVPCPNPDWPDVYTRVASYID 352
            :| |:.:...|.|::||||   .||.::.|        |::|.|...|   |...|||.:.|:.|
  Fly   200 ICAGVPSGDTCGGDSGGPL---TNDVFIQGIGNREVQFGIISVGKTSC---DGQGVYTDLMSFAD 258

  Fly   353 WI 354
            ||
  Fly   259 WI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 70/262 (27%)
Tryp_SPc 111..354 CDD:214473 68/260 (26%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 68/260 (26%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.