DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and F10

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:400 Identity:102/400 - (25%)
Similarity:150/400 - (37%) Gaps:112/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GRVTGHCI---SIRECDYFMRILLSGNLSQSDRNLLRDNQCGVRGNDVQVCCP---STAGLGALT 92
            |..|..|:   ..:.|:.|.|.|.|  |...|    .|..|....|.|...|.   :.|..|...
Human   106 GEYTCTCLEGFEGKNCELFTRKLCS--LDNGD----CDQFCHEEQNSVVCSCARGYTLADNGKAC 164

  Fly    93 HPLLPSDCGK-----------------------VRW-------------------------QRSN 109
            .|..|..|||                       :.|                         :|.:
Human   165 IPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDPTENPFDLLDFNQTQPERGD 229

  Fly   110 DTDTRI--------REFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITA 166
            :..|||        .|.||.||:.    |:|....|||.::|:.|:||||||:.||....     
Human   230 NNLTRIVGGQECKDGECPWQALLI----NEENEGFCGGTILSEFYILTAAHCLYQAKRFK----- 285

  Fly   167 VRLGEWDTSTNPDCQ-YHEDSKVADCAPPYQDIAIEELLPHPLYNR-TDRTQINDIALVRLASPA 229
            ||:|:.:|......: .||               :|.::.|   || |..|...|||::||.:|.
Human   286 VRVGDRNTEQEEGGEAVHE---------------VEVVIKH---NRFTKETYDFDIAVLRLKTPI 332

  Fly   230 KLNDFVQPICLPNKQLRADELED-LVTEVAGWQASSSQRMRKG-------YVTISSIEECQRKYA 286
            .....|.|.|||.:    |..|. |:|:..|..:...:...||       .:.:..::....|.:
Human   333 TFRMNVAPACLPER----DWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLS 393

  Fly   287 SQQLRIQASKLCGLTNSQE--CYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVAS 349
            |..:..|.....|....||  |.|::|||.:....|.|.:.|:||:|. .|.......:||:|.:
Human   394 SSFIITQNMFCAGYDTKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGE-GCARKGKYGIYTKVTA 457

  Fly   350 YIDWIHDSLK 359
            ::.||..|:|
Human   458 FLKWIDRSMK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 14/50 (28%)
Tryp_SPc 111..356 CDD:238113 76/264 (29%)
Tryp_SPc 111..354 CDD:214473 74/262 (28%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011 3/15 (20%)
FXa_inhibition 129..164 CDD:317114 10/40 (25%)
O-glycosylated at one site 183..203 1/19 (5%)
Tryp_SPc 235..464 CDD:238113 74/260 (28%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.