DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and C1s

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_620255.2 Gene:C1s / 192262 RGDID:619983 Length:694 Species:Rattus norvegicus


Alignment Length:377 Identity:98/377 - (25%)
Similarity:155/377 - (41%) Gaps:89/377 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ANAQL--PPINC---------VAKIPSGRVTGHCI--SIRECDYFMRILLSGNLSQSDRNLLRDN 69
            :|::|  .|::|         ..:.|...|.|..|  :..|..|:|.....|....:......::
  Rat   354 SNSRLECQPVDCGVPEPIENGKVEDPEDTVFGSVIHYTCEEPYYYMEQEEGGEYHCAANGSWVND 418

  Fly    70 QCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKI 134
            |.||   ::..|.|.   .|..|.|.      ||:.:......|:|:.|||....|..||     
  Rat   419 QLGV---ELPKCIPV---CGVPTEPF------KVQQRIFGGYSTKIQSFPWQVYFESPRG----- 466

  Fly   135 HACGGVLISDRYVLTAAHC-------VAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCA 192
               ||.||.:.:||||||.       |....::.|:|..:|..                      
  Rat   467 ---GGALIDEYWVLTAAHVVEGNSDPVMYVGSTLLKIERLRNA---------------------- 506

  Fly   193 PPYQDIAIEELLPHPLYNRTD----RTQI-NDIALVRLASPAKLNDFVQPICLPNKQLRADELED 252
               |.:..|.::.||.:.:.|    ||.. ||||||:|..|.|:...|.|||||......:..|.
  Rat   507 ---QRLITERVIIHPSWKQEDDLNTRTNFDNDIALVQLKDPVKMGPTVAPICLPETSSDYNPSEG 568

  Fly   253 LVTEVAGWQASSSQ----RMRKGYVTISSIEECQR------KYASQQLRIQASKLC-GLTNSQEC 306
            .:..::||..:.::    ::|...:.|:|:|:||:      |..|.......:.:| |......|
  Rat   569 DLGLISGWGRTENRTNVIQLRGAKLPITSLEKCQQVKVENPKARSNDYVFTDNMICAGEKGVDSC 633

  Fly   307 YGNAGG----PLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354
            .|::||    |:...|:..:.:.||||:|. .|..   ..:||:|.:|:|||
  Rat   634 EGDSGGAFALPVPNVKDPKFYVAGLVSWGK-KCGT---YGIYTKVKNYVDWI 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 11/53 (21%)
Tryp_SPc 111..356 CDD:238113 76/271 (28%)
Tryp_SPc 111..354 CDD:214473 74/269 (28%)
C1sNP_620255.2 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:405372
CUB 181..293 CDD:395345
CCP 300..361 CDD:153056 2/6 (33%)
CCP 365..428 CDD:153056 12/65 (18%)
Tryp_SPc 443..681 CDD:214473 74/274 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.