DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and try-5

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:263 Identity:60/263 - (22%)
Similarity:102/263 - (38%) Gaps:74/263 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWLALI--EYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQ 181
            ||...|  :..:|:.|.|  |||.||:.::|||||||..:...:..:     .||.::.:...|:
 Worm    55 PWAVQIRVKARKGDFEVI--CGGTLITLKHVLTAAHCFQKHFGAKKE-----GGEENSMSGRYCE 112

  Fly   182 YHE---DSKVA------------------DCAPPYQD---IAIEELLPHPLYNRTDRTQINDIAL 222
            .::   ||::.                  .|....|:   :.|........| :|...|.|||.:
 Worm   113 SNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKISRFAIGDFY-KTHCEQGNDIVI 176

  Fly   223 VRLASPAKLNDFVQPICLP-----NKQLRADELEDLVTEVAGWQASSSQRMRKGY---------- 272
            :.|.|.....:.....|||     |.|..|:     ||.. ||.:...    ||:          
 Worm   177 LELESTIDDVEGANYACLPFLPEVNIQSGAN-----VTSF-GWGSDPG----KGFDNAAFPMIQV 231

  Fly   273 --VTISSIEECQRKYASQQLRIQASKLCGLTNSQE----CYGNAGGPLMLFKNDG---YLLGGLV 328
              :...::..|:..:.:.   |.....|  |..:|    |.|::||.|...::|.   ::: .:|
 Worm   232 LTLATETLATCEENWGTS---IPFDSFC--TAEEEDKNVCSGDSGGGLTFHQSDSAREFII-AIV 290

  Fly   329 SFG 331
            |:|
 Worm   291 SYG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 60/263 (23%)
Tryp_SPc 111..354 CDD:214473 60/263 (23%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 60/263 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.