DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and try-10

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:276 Identity:71/276 - (25%)
Similarity:107/276 - (38%) Gaps:87/276 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 TRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITA-VRLGEWDTSTNPDCQYHEDSKVAD 190
            ||......:.||||||:...|:|:||||...  .:..:|| |.||  |...|.    |:|.:   
 Worm    94 TRFPDGTTNVCGGVLIAPSIVITSAHCVFSG--DDFAVTAKVTLG--DVHLNK----HDDGE--- 147

  Fly   191 CAPPYQDIAIEELLPHPL------YNRTDRTQIN-DIALVRLASPAKLNDFVQPICL-------- 240
                      :|...|.:      :|  |.::.| |:|::.|  |.:.:....|:.|        
 Worm   148 ----------QEFRSHAMAISKKFFN--DASEANDDVAVIFL--PQRADVCHSPLSLQIAKLPST 198

  Fly   241 ---------PNKQLRADELEDLVTEVAGW------QASSSQRMRKGYVTISSIEECQRKYASQQL 290
                     |..||   :||..|..||||      .|..|..:|:..|.:|.....:|||     
 Worm   199 GSVNFKETAPLTQL---QLETSVCYVAGWGKTENKTAKYSDSVRQMMVNLSVRRIGKRKY----- 255

  Fly   291 RIQASKLCGLTNSQECYGNAGGPLMLFKNDGYLLGGLV----SFGPVPCPNP------------- 338
             :.|..:.|  :|:.|.|::|.|:..|.|...:|.|.|    ||..:...:|             
 Worm   256 -LIAKAVTG--SSRACMGDSGSPVYCFVNGKRILVGTVAHIGSFSKMSEQDPSNHISFCRDFEYT 317

  Fly   339 ---DWPDVYTRVASYI 351
               ||.:...||...:
 Worm   318 FVSDWRESSERVVEIL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 71/276 (26%)
Tryp_SPc 111..354 CDD:214473 71/276 (26%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 63/231 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.