DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and try-1

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:328 Identity:88/328 - (26%)
Similarity:138/328 - (42%) Gaps:73/328 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILLSG---NLSQSDRN-LLRDNQCGVRGNDVQVC----CPSTAGLGALTHPLLPSDCGKVRWQRS 108
            :||.|   .:|..::| ::....||:...:|::.    ....|....|.|.|:            
 Worm     7 LLLVGVINKVSTDNKNDVIEKVGCGLHSTNVELAQTRSAQEPADYVTLDHRLI------------ 59

  Fly   109 NDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVA--QAATSNLQITAVRLGE 171
            ..:::....:||...:....|:    |.|||.||...:|||||||.|  :..||    .:||:|.
 Worm    60 GGSESSPHSWPWTVQLLSRLGH----HRCGGSLIDPNFVLTAAHCFAKDRRPTS----YSVRVGG 116

  Fly   172 WDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQ 236
                       |....    ..|::..|:.   .||.|| .......|.|::|:..|...:...:
 Worm   117 -----------HRSGS----GSPHRVTAVS---IHPWYN-IGFPSSYDFAIMRIHPPVNTSTTAR 162

  Fly   237 PICLPNKQLRADELEDLVTEVAGWQAS------SSQRMRKGYVTISSIEECQR--KYASQQLRIQ 293
            |||||:    ...:|:.:..|.||.::      |:..:|:.:|.:.|...|..  .|..   ||.
 Worm   163 PICLPS----LPAVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIG---RIH 220

  Fly   294 -ASKLC-----GLTNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYID 352
             .|.||     |..:|  |.|::|||||..::..:.|.|:||:| :.|..|..|.||..|.|...
 Worm   221 LPSMLCAGYSYGKIDS--CQGDSGGPLMCARDGHWELTGVVSWG-IGCARPGMPGVYGNVHSAST 282

  Fly   353 WIH 355
            ||:
 Worm   283 WIN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 8/37 (22%)
Tryp_SPc 111..356 CDD:238113 76/261 (29%)
Tryp_SPc 111..354 CDD:214473 74/258 (29%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 75/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.