DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG43742

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:233 Identity:65/233 - (27%)
Similarity:98/233 - (42%) Gaps:52/233 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 CGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTN-PDCQY--HEDSKVADCAPPYQDI 198
            |||.||..:|||||||||     .:|....|.|||.:.|.. |.|::  ..::||          
  Fly    58 CGGSLIHKQYVLTAAHCV-----RDLDEVTVHLGENNRSCPIPVCKHVLRLNAKV---------- 107

  Fly   199 AIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTE------- 256
                 :.||  |......:|||||:||.........::|||:        .|::.||.       
  Fly   108 -----ILHP--NFHGNIFLNDIALLRLEREVIFEAHIRPICI--------ILDEDVTSNNQNNFT 157

  Fly   257 VAGWQASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLC-GLTNSQECYGNAGGPLM-LFKN 319
            ..||..:....: ...::...:....:....|.:    :.:| |.|:...|..::||||: .|.:
  Fly   158 AYGWGKTEHGNI-SDVLSFIDLVRLPKSMCYQNI----NTICAGSTSGDTCESDSGGPLIGNFVH 217

  Fly   320 DGY---LLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354
            .|.   :|.|:.|:|...|..  ...|||.|.:|..||
  Fly   218 RGKSRDILFGITSYGDAECSG--LFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 65/233 (28%)
Tryp_SPc 111..354 CDD:214473 63/231 (27%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 63/231 (27%)
Tryp_SPc 35..256 CDD:238113 65/233 (28%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.