DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG43336

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:303 Identity:87/303 - (28%)
Similarity:132/303 - (43%) Gaps:70/303 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQE 132
            |..||:|.:.                |.:|    :|:    |.|...:...||:|.:..|.|.  
  Fly    23 DMACGIRAHS----------------PSVP----RVK----NGTVASLTSSPWMAFLHSTDGR-- 61

  Fly   133 KIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQD 197
              ..|||.||::|.|||||||.    ....::.| ||||:|         .|:.::  |...|..
  Fly    62 --FICGGSLITNRLVLTAAHCF----LDRTELVA-RLGEYD---------REEYEM--CHDSYCT 108

  Fly   198 IAIEELLP----HPLYNRTDRTQINDIALVRLASPAKLNDFVQPICL---PNKQLRADELEDLVT 255
            ..||.::.    |..||  ..|...|||::||....:..|.::|||:   |..:...|.|:.|..
  Fly   109 YRIEAMVERGFRHRHYN--PMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTG 171

  Fly   256 EVAGWQASSSQ----RMRKGYVTISSIEECQRKYASQQLRIQASKLC-GLTNSQECYGNAGGPLM 315
              .||..:.|:    ::|...:.....|.| |:||:  |.:.|::.| |...|..|.|::|||:.
  Fly   172 --TGWGKTESEGDSAKLRTVDLARKHPEVC-RRYAT--LSLTANQFCAGNERSNLCNGDSGGPVG 231

  Fly   316 LF----KNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354
            ..    |:..::..|:.||....|.   ...|:|.|.||:|||
  Fly   232 ALIPYGKSKRFVQVGIASFTNTQCV---MVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 4/13 (31%)
Tryp_SPc 111..356 CDD:238113 79/260 (30%)
Tryp_SPc 111..354 CDD:214473 77/258 (30%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 79/267 (30%)
Tryp_SPc 40..271 CDD:238113 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.