DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG43335

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:281 Identity:80/281 - (28%)
Similarity:135/281 - (48%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LLPSDCGKVRWQRS-------NDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAH 152
            ||..:|| :|...|       ..:|..|...||:|.:     ..|..:.|.|.||::::||||||
  Fly    24 LLEPNCG-IRTMPSFHRTRIIGGSDAEITSHPWMAYL-----YNEFHYFCAGTLITNQFVLTAAH 82

  Fly   153 CVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQI 217
            |:  .|:.||   .||||....:       ..|..:  |....:|.::...:.|..:  |....:
  Fly    83 CI--EASKNL---TVRLGGSGLT-------RSDGSM--CQITAEDYSVSMAIKHKYF--TPSIML 131

  Fly   218 NDIALVRLASPAKLNDFVQPICL---PNKQLRADELEDLVTEVA-GWQASSSQR----MRKGYVT 274
            ||||::|||...|..|.::|||:   |..:|.   |||.:|.:| ||..:..:.    :::..:|
  Fly   132 NDIAMIRLARTVKFYDHIRPICIILDPAVRLL---LEDGMTLMATGWGLADKRMHPHLLQEAPIT 193

  Fly   275 ISSIEECQRKYASQQLRIQASKLC-GLTNSQECYGNAGGPL---MLFKND-GYLLGGLVSFGPVP 334
            :.:...|.:.|   .:.|...::| |...:..|.|::||||   :.:..| .::..|:.|||.:.
  Fly   194 VMNRNVCSKLY---DVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIE 255

  Fly   335 CPNPDWPDVYTRVASYIDWIH 355
            |.:   |.:||.:::|..||:
  Fly   256 CRS---PSIYTDLSTYSGWIN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 74/258 (29%)
Tryp_SPc 111..354 CDD:214473 72/255 (28%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 72/260 (28%)
Tryp_SPc 42..275 CDD:238113 74/262 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.