DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG43124

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:243 Identity:61/243 - (25%)
Similarity:96/243 - (39%) Gaps:63/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYH 183
            ||||.|.    :..|: .|.|.||::.||||||.|..:    |.::| ||||.         .|.
  Fly    41 PWLAEIL----SDSKV-ICAGALINNLYVLTAASCFKE----NEKLT-VRLGS---------GYF 86

  Fly   184 EDSKVADCAPPYQDIAIEEL---LPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICL---PN 242
            :.|        |::..:.:.   :.|...|.|     |::.:.||.:..:....::|:|:   |.
  Fly    87 DKS--------YENFRVTKAYFWMTHFPANNT-----NNLCIFRLQTEVEFKTHIRPMCITKSPK 138

  Fly   243 KQLRADELEDLVTEVAGWQASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTNSQECY 307
            ....|...|.:..:...|....:   .||........|.:.|:.|:.           |.|....
  Fly   139 SLGLATTFEIINEKPKMWYFCKN---IKGLFCKYVFGENEEKWQSKP-----------TGSPWTE 189

  Fly   308 GNAGGPLMLFKNDGYLLGGLVSFGPVPC-PNPDWPDVYTRVASYIDWI 354
            ..:.||   ||       |||.:|.:.. .|..:.:||..|.|:|:||
  Fly   190 TISNGP---FK-------GLVRYGILSYRDNKTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 61/243 (25%)
Tryp_SPc 111..354 CDD:214473 59/241 (24%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 33/123 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.