DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG43125

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:296 Identity:68/296 - (22%)
Similarity:97/296 - (32%) Gaps:116/296 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATS 160
            |..:|||         .:.....|||..|   |........|.|.||::|:|||||.|:..... 
  Fly    23 LEQNCGK---------SSVFSPAPWLVKI---RPELSSNITCTGTLINERFVLTAASCIDYQTE- 74

  Fly   161 NLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRL 225
                ..|||||.|.:      ....||:     .|::|.:...|.|..|: ::..|.| |||:||
  Fly    75 ----LIVRLGEIDGT------LQNSSKL-----QYEEIYVARALIHRSYS-SESHQYN-IALLRL 122

  Fly   226 ASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQASSSQRMRKGYVTISSIEECQRKYASQQL 290
            .:.......:||||:.                          :..|.|..:...|.::|      
  Fly   123 KTSVVYKKNIQPICID--------------------------VNVGKVPKAPTFEIEKK------ 155

  Fly   291 RIQASKLCGLTNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPD-----------WP--- 341
                       .::|...|..|.:..|      |...:|...|..|.||           ||   
  Fly   156 -----------KNEEPKKNKAGIMKRF------LNWFLSLFGVREPRPDVILPPQPIAVGWPLTK 203

  Fly   342 -----------------------DVYTRVASYIDWI 354
                                   ||||.|.:|::||
  Fly   204 QINESALFHQYGILSHRNSESKKDVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 64/281 (23%)
Tryp_SPc 111..354 CDD:214473 62/279 (22%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 39/120 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.