DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and LOC1269288

DIOPT Version :10

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_307910.5 Gene:LOC1269288 / 1269288 VectorBaseID:AGAMI1_004229 Length:401 Species:Anopheles gambiae


Alignment Length:39 Identity:11/39 - (28%)
Similarity:19/39 - (48%) Gaps:3/39 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IQRYTPY-QSRQFGPISNNVCNFRHVDANQYNTNFMEYQ 187
            :||:..: |.....|.:..:|| .|...|.:..| |:|:
Mosquito    32 LQRWIDFCQRDNINPTTACICN-EHFAPNDFERN-MQYE 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 32..82 CDD:463440
Tryp_SPc 111..356 CDD:238113 11/39 (28%)
LOC1269288XP_307910.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.