DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG42694

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:280 Identity:68/280 - (24%)
Similarity:103/280 - (36%) Gaps:91/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SNDTDTRIREFP---WLALIEYTRGNQEKIHA-CGGVLISDRYVLTAAHCV-------AQAATSN 161
            ||.:.|::|: |   |||.|  :.|.    |. |.|.|||.::||:||.|:       .|...||
  Fly    32 SNQSITKLRQ-PQAGWLAHI--SNGT----HVLCSGSLISKQFVLSAAQCIDVHGKLFVQLGVSN 89

  Fly   162 LQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLA 226
                |.:...|.|.:|.....|...::.                            .||.|::|:
  Fly    90 ----ATKSPHWYTVSNVVIPSHSGKRLQ----------------------------RDIGLLKLS 122

  Fly   227 SPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQASSSQRMRKGYVTI----SSIEECQRKYAS 287
            .....||||.|||:   .|..:.| |:|..:..:..|:.....|...||    .|.:.|:...:.
  Fly   123 QSVDYNDFVYPICI---ALNTNTL-DMVKILQNFTTSAWLSKNKNPQTIVLSQLSRDRCKLNLSG 183

  Fly   288 QQLRIQASKLC--GLTNSQECYGNAGGPL-------------MLFKNDGYLLGGLVSFGPVPCPN 337
               .:...::|  .|..:..|:.::|..|             |||...||:.|            
  Fly   184 ---NVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNG------------ 233

  Fly   338 PDW---PDVYTRVASYIDWI 354
            ..|   |.:|..||..:.||
  Fly   234 RSWCSEPAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 66/277 (24%)
Tryp_SPc 111..354 CDD:214473 64/275 (23%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 63/265 (24%)
Tryp_SPc 46..253 CDD:214473 61/263 (23%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.