DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and LOC100004411

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:269 Identity:81/269 - (30%)
Similarity:134/269 - (49%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 DTRI------RE--FPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVR 168
            ||||      |:  .||..|:.    .:::...|||.||:.|:|:|||||:.|....      :.
Zfish   246 DTRIVGGQLQRQGGSPWQVLLR----REDEYGFCGGSLINQRWVITAAHCLQQTPHH------IT 300

  Fly   169 LGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLND 233
            :|::| ...||    :|.         |.|.:|:::|||.|:  :.|..:||||:.|:|...|..
Zfish   301 IGDYD-KMRPD----KDE---------QKITVEKIIPHPHYH--EYTFDSDIALLYLSSAVTLGP 349

  Fly   234 FVQPICLPNKQLRADEL-----EDLVTEVAGWQAS-----SSQRMRKGYVTISSIEECQRKYASQ 288
            |..|.|||:..| |:.|     :.|   |:||.::     ||:.:||  |.:..:|:.....:::
Zfish   350 FASPACLPDANL-AERLMKPGEQGL---VSGWGSTHYLQRSSRFLRK--VQLPVVEQKSCINSTE 408

  Fly   289 QLRIQASKLCG---LTNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASY 350
            |: |..:..|.   :.....|.|::|||.::.....:.|.|:||:|. .|.:.....||||:.:|
Zfish   409 QI-ITDNMFCAGFLMEEMDACTGDSGGPFIVNYRGTWFLTGVVSWGE-RCASQGKYGVYTRLGNY 471

  Fly   351 IDWIHDSLK 359
            :.||.:.:|
Zfish   472 LSWIQEEMK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 80/264 (30%)
Tryp_SPc 111..354 CDD:214473 78/262 (30%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 128..164 CDD:291342
Tryp_SPc 248..475 CDD:214473 76/260 (29%)
Tryp_SPc 249..477 CDD:238113 77/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.