DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and Ciita

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_445981.2 Gene:Ciita / 85483 RGDID:619813 Length:1153 Species:Rattus norvegicus


Alignment Length:322 Identity:75/322 - (23%)
Similarity:117/322 - (36%) Gaps:82/322 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RYLELCRAKNLTPVPEI-RSKSNATTTFLELCGDKLAVSDWQLLTEALHYDLVLQQLVVRLRRTY 107
            |.|||....:.|..|.| :..|:.....|...|.:|...|..:|..||  :...|...:.||   
  Rat   828 RLLELLHCAHETQEPGIWKHVSHQLPGHLSFLGTRLTAPDVYVLGRAL--ETASQDFSLDLR--- 887

  Fly   108 PQTNIDP----------------------------IDTEKRARLFRQRPVIYTRFIF-------- 136
             ||.|:|                            :..:...:|.:.....:|...|        
  Rat   888 -QTGIEPSRLGDLVGLSCVTSFRASLSDTMALWESLQHQGETQLLQAAEEKFTIEPFKAKSPKDV 951

  Fly   137 ---NSLVQA--IAN-CVSSNKNLSVL----KLE---GLPLQDGYIETIAK---ALADNECLESVS 185
               :||||.  :.| ...:.|:|..:    |||   |..|......|:||   |.:..:.|:..|
  Rat   952 EDLDSLVQTQRLRNPSADAAKDLPAIRDLKKLEFALGPVLGPQAFPTLAKILPAFSSLQHLDLDS 1016

  Fly   186 FRKSNIGDKGCEVVCNTAKYLNRIEVFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYR 250
            ..::.|||||...:..|...|..:|..:||:..:|..||..:|:.|         ....|||   
  Rat  1017 LSENKIGDKGVSKLSATFPQLKALETLNLSQNSITDVGACKLAEAL---------PALAKSL--- 1069

  Fly   251 SVDVNTIGGLRTVLLADNPEIGDVGIRWITEVLKEDAWIKKIDMEGCGLTDIGANLILDCLE 312
                     ||..|.  |..|.|.|.:.:..||.:...::.:|::....|.:||..:...|:
  Rat  1070 ---------LRLSLY--NNCICDEGAKSLARVLPDMVSLRVMDVQFNKFTAVGAQQLTSSLQ 1120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 46/184 (25%)
leucine-rich repeat 153..180 CDD:275381 10/36 (28%)
leucine-rich repeat 181..208 CDD:275381 9/26 (35%)
leucine-rich repeat 209..246 CDD:275381 8/36 (22%)
leucine-rich repeat 260..285 CDD:275381 9/24 (38%)
CiitaNP_445981.2 NACHT 441..610 CDD:283404
LRR_RI 812..1137 CDD:238064 75/322 (23%)
leucine-rich repeat 980..997 CDD:275381 5/16 (31%)
leucine-rich repeat 1012..1039 CDD:275380 9/26 (35%)
leucine-rich repeat 1040..1068 CDD:275380 8/36 (22%)
leucine-rich repeat 1069..1096 CDD:275380 10/40 (25%)
leucine-rich repeat 1097..1124 CDD:275380 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.