DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and NLRX1

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001269072.1 Gene:NLRX1 / 79671 HGNCID:29890 Length:975 Species:Homo sapiens


Alignment Length:466 Identity:93/466 - (19%)
Similarity:161/466 - (34%) Gaps:136/466 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 EALHYDLVLQQ-----LVVRLRRTYPQTNIDPIDTEKRARLFRQRPVI-------YTRFIFNSL- 139
            |..:.|.||.|     |.|...|.:|.   :|.:.|    :|...|:.       :.|.:...| 
Human   586 EDYYNDDVLDQMGASILGVEGPRRHPD---EPPEDE----VFELFPMFMGGLLSAHNRAVLAQLG 643

  Fly   140 -----VQAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKALADN--------------ECLESVS 185
                 :.|:.|..:..|.|..|..:.||..:         |.|:              |.|.|: 
Human   644 CPIKNLDALENAQAIKKKLGKLGRQVLPPSE---------LLDHLFFHYEFQNQRFSAEVLSSL- 698

  Fly   186 FRKSNI-GDKGCEVVCNTAKYL-----NRIEVFDLSECGLTSKGAEHVADM-LKMQKITRFTEGW 243
             |:.|: |.:...|.|.....:     :.::..:|:.|.|...|...:..: |:.:|:       
Human   699 -RQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKL------- 755

  Fly   244 EKSLRYRSVDVNTIGGLRTVLLAD----------NPEIGDVGIRWITEVLKEDAWIKKIDMEGCG 298
              .|:..|:.......||.:||.|          |..:...|:..:.|.|..:..:..:.:...|
Human   756 --GLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTG 818

  Fly   299 LTDIGANLILDCLELNTAITEFNVRNNEGISKFLQRSIHDRLGCLPEEKQEPEYDLSCVNGLQSL 363
            |.|.|..|:...|:.|..:.|.||                                 ..||... 
Human   819 LGDEGLELLAAQLDRNRQLQELNV---------------------------------AYNGAGD- 849

  Fly   364 PKNKKVTVSQLLSHTKALEEQLSFERTLRKKAEKLNEKLSHQLMRPDSNHMVQEKAMEGGSQTNI 428
                    :..|:..:|..|..|.| .|.....:|:.: ..|::|....      |.|||::..:
Human   850 --------TAALALARAAREHPSLE-LLHLYFNELSSE-GRQVLRDLGG------AAEGGARVVV 898

  Fly   429 S-REYVARND----VMPEVIKNSQSYRQSHFNRLVNSAATSPEVTPRSEIVTLRKEQQLQRQQPP 488
            | .|..|.::    ::.||.:|..|:.::...|.:.......|.:..:.:...||.|.|:.:.  
Human   899 SLTEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEG-- 961

  Fly   489 PMEVKHLSLEQ 499
              ||:.| |||
Human   962 --EVRAL-LEQ 969

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 41/208 (20%)
leucine-rich repeat 153..180 CDD:275381 6/40 (15%)
leucine-rich repeat 181..208 CDD:275381 7/32 (22%)
leucine-rich repeat 209..246 CDD:275381 6/37 (16%)
leucine-rich repeat 260..285 CDD:275381 9/34 (26%)
NLRX1NP_001269072.1 Required for interaction with MAVS. /evidence=ECO:0000269|PubMed:18200010 75..556
P-loop_NTPase 161..320 CDD:304359
Required for the repression of MAVS-induced interferon signaling 556..974 93/466 (20%)
LRR_RI <698..885 CDD:238064 42/241 (17%)
leucine-rich repeat 698..726 CDD:275380 5/29 (17%)
leucine-rich repeat 745..772 CDD:275380 5/35 (14%)
leucine-rich repeat 773..808 CDD:275380 7/34 (21%)
leucine-rich repeat 809..836 CDD:275380 7/26 (27%)
leucine-rich repeat 865..886 CDD:275380 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.