DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and Lrrc74b

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_083329.2 Gene:Lrrc74b / 74685 MGIID:1921935 Length:391 Species:Mus musculus


Alignment Length:382 Identity:84/382 - (21%)
Similarity:137/382 - (35%) Gaps:105/382 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YLELCRAKNLTPVPEIRSKSNATTTFLELCGDKLAVSDWQLLTEALHYDLVLQQLVVRLRRTYPQ 109
            ||:.|||.::.||..:..:..|:                              :|.:|.|...||
Mouse    58 YLKSCRANSVVPVSCLLRQEGAS------------------------------ELNLRHRGLGPQ 92

  Fly   110 TNIDPIDTEKRARLFRQRPVIYTRFIFNSLVQAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKA 174
            .                             |:|:|:.::||..:..|.|....|.....|.:|..
Mouse    93 G-----------------------------VRALASVLTSNPYIKRLDLRDNGLCGAGAEALADV 128

  Fly   175 LADNECLESVSFRKSNIGDKGCEVVCNTAKYLN-RIEVFDLSECGLTSKGAEHVADMLKMQKITR 238
            |..|..:..|...::.||..|.:.:| ||..|| .:|...|....|..:.|:|:|.:|.      
Mouse   129 LRKNSIISDVDLSENQIGAAGLQAIC-TALALNPTVEKMQLQGNRLEEQAAQHLAALLL------ 186

  Fly   239 FTEGWEKSLRYRSVDVNTIGGLRTVLL----ADNPEIGDVGIRW----------ITEVLKEDAWI 289
                ..:.|:...:..|.:..|...:|    |:|..:.::.:.|          ....|:.:.::
Mouse   187 ----HHRGLKSLDLSYNQLNDLAGEILGPAVAENTGLTELNLSWNHLRGLGATAFARGLEANIFL 247

  Fly   290 KKIDMEGCGLTDIGANLILDCLELNTAITEFNVRNN----EGISKF-LQRSIHDRLGCLPEEKQE 349
            |.:|:...|..|.||:.|.|.|.:|..:.|.|:|||    .|..|. |...::..|..|...|..
Mouse   248 KVLDISHNGFGDSGASAIGDALRVNNVLEELNMRNNRISVSGALKLGLGLQVNQTLRILIISKNP 312

  Fly   350 PEYDLSCVNGLQSLPKNKKVTVSQLLSHTKALE----EQLSFERTLRKKAEKLNEKL 402
            ...| .||..|:|:..||          :.|||    ..:...|.....|..::|.|
Mouse   313 IRSD-GCVGLLKSVRNNK----------SSALELLDVSDIQVSRECEDLASSMSEIL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 45/192 (23%)
leucine-rich repeat 153..180 CDD:275381 7/26 (27%)
leucine-rich repeat 181..208 CDD:275381 9/27 (33%)
leucine-rich repeat 209..246 CDD:275381 7/36 (19%)
leucine-rich repeat 260..285 CDD:275381 6/38 (16%)
Lrrc74bNP_083329.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
LRR_RI 56..353 CDD:238064 82/375 (22%)
leucine-rich repeat 81..106 CDD:275380 10/53 (19%)
LRR 1 106..126 4/19 (21%)
leucine-rich repeat 107..128 CDD:275380 5/20 (25%)
LRR 2 134..154 4/19 (21%)
leucine-rich repeat 159..190 CDD:275380 9/40 (23%)
LRR 3 162..182 5/19 (26%)
LRR_8 189..257 CDD:290566 10/67 (15%)
LRR 4 190..211 4/20 (20%)
leucine-rich repeat 191..218 CDD:275380 6/26 (23%)
LRR 5 218..239 1/20 (5%)
leucine-rich repeat 219..243 CDD:275380 2/23 (9%)
LRR 6 246..259 3/12 (25%)
leucine-rich repeat 247..270 CDD:275380 8/22 (36%)
LRR 7 274..294 7/19 (37%)
leucine-rich repeat 275..292 CDD:275380 6/16 (38%)
LRR 8 302..323 6/21 (29%)
leucine-rich repeat 303..332 CDD:275380 10/39 (26%)
LRR 9 332..354 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.