| Sequence 1: | NP_650378.1 | Gene: | CG7886 / 41775 | FlyBaseID: | FBgn0038248 | Length: | 818 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_071445.1 | Gene: | NOD2 / 64127 | HGNCID: | 5331 | Length: | 1040 | Species: | Homo sapiens |
| Alignment Length: | 231 | Identity: | 47/231 - (20%) |
|---|---|---|---|
| Similarity: | 90/231 - (38%) | Gaps: | 57/231 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 126 QRPVIYTRFIFNSLVQAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKALADNECLESVSFRKSN 190
Fly 191 IGDKGCEVVCNTAKYLNRIEVFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDVN 255
Fly 256 TIGGLRTVLLA--------------DNPEIGDVGIRWITEVLKEDAWIKKIDMEGCGLTDIGANL 306
Fly 307 ILDCLELNTAITEFNVRNNEGISKFLQRSIHDRLGC 342 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7886 | NP_650378.1 | LRR_RI | <142..320 | CDD:238064 | 38/191 (20%) |
| leucine-rich repeat | 153..180 | CDD:275381 | 5/26 (19%) | ||
| leucine-rich repeat | 181..208 | CDD:275381 | 5/26 (19%) | ||
| leucine-rich repeat | 209..246 | CDD:275381 | 3/36 (8%) | ||
| leucine-rich repeat | 260..285 | CDD:275381 | 6/38 (16%) | ||
| NOD2 | NP_071445.1 | DD | 34..119 | CDD:301326 | |
| ATG16L1-binding motif | 63..77 | ||||
| CARD_NOD2_2_CARD15 | 134..214 | CDD:260056 | |||
| Required for CARD9 binding. /evidence=ECO:0000269|PubMed:24960071 | 241..274 | ||||
| NACHT | 293..463 | CDD:283404 | |||
| leucine-rich repeat | 764..791 | CDD:275381 | |||
| LRR_RI | 767..1032 | CDD:238064 | 44/228 (19%) | ||
| LRR 1 | 791..812 | ||||
| LRR | <795..1040 | CDD:227223 | 47/231 (20%) | ||
| leucine-rich repeat | 795..816 | CDD:275380 | |||
| LRR 2 | 816..839 | ||||
| leucine-rich repeat | 820..844 | CDD:275380 | |||
| LRR 3 | 844..865 | 1/18 (6%) | |||
| leucine-rich repeat | 845..868 | CDD:275380 | 2/21 (10%) | ||
| leucine-rich repeat | 869..900 | CDD:275380 | 6/30 (20%) | ||
| LRR 4 | 872..884 | 3/11 (27%) | |||
| LRR 5 | 900..920 | 5/43 (12%) | |||
| leucine-rich repeat | 901..928 | CDD:275380 | 8/64 (13%) | ||
| LRR 6 | 928..949 | 8/20 (40%) | |||
| leucine-rich repeat | 929..952 | CDD:275380 | 8/22 (36%) | ||
| LRR 7 | 956..976 | 2/19 (11%) | |||
| leucine-rich repeat | 957..984 | CDD:275380 | 5/26 (19%) | ||
| LRR 8 | 984..1005 | 4/20 (20%) | |||
| leucine-rich repeat | 985..1006 | CDD:275380 | 5/20 (25%) | ||
| LRR 9 | 1012..1032 | 6/24 (25%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||