DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and Lrrc74a

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001182696.1 Gene:Lrrc74a / 627607 MGIID:3646959 Length:487 Species:Mus musculus


Alignment Length:504 Identity:104/504 - (20%)
Similarity:190/504 - (37%) Gaps:147/504 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 QTNIDPIDTEK------------RARLFRQRPVIYTRFIFNSLVQAIANCVSSN----------- 150
            :|:::..||||            ..:|....|..|  ||.|    ...:||:.|           
Mouse    51 ETDLEIEDTEKFFNIGQKELYLEACKLVGVVPASY--FIRN----MEESCVNLNHHGLGPMGTKA 109

  Fly   151 ------KNLSVLKLEGLPLQDGYIE-----TIAKALADNECLESVSFRKSNIGDKGCEVVCNTAK 204
                  .|.:|||||   |.|..|:     ::.:.|.:|..|:.::...:|:|.:|..::.|..:
Mouse   110 IAITLVSNTTVLKLE---LGDNCIQEEGIMSLMEMLHENYYLQELNVSDNNLGLEGARIISNFLQ 171

  Fly   205 YLNRIEVFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDV-----NTIGGLRT-V 263
            . |...::.|...|.:.|  |..|.:|        .:....:.|.||:::     :.|||... .
Mouse   172 E-NNSSLWKLKLSGNSFK--EECAALL--------CQALSSNYRIRSLNLSHNEFSDIGGEHLGQ 225

  Fly   264 LLADNPEIGDVGIRW----------ITEVLKEDAWIKKIDMEGCGLTDIGANLILDCLELNTAIT 318
            :||.|..:..:.:.|          :...|:.:..:||:|:...|..:.||..:.|.|.||:.:.
Mouse   226 MLALNVGLQSLNLSWNHFNIRGAVALCNGLRSNVTLKKLDVSMNGFGNEGALALGDALRLNSCLV 290

  Fly   319 EFNV-RN---NEGISKFLQRSIHDRLGCLPEEKQEPEYDLSCVNGLQSLPKNKKVTVSQLLSHTK 379
            ..:| ||   |||.||..:                         ||::   |:.:.|.:|..:..
Mouse   291 YVDVSRNGITNEGASKISK-------------------------GLEN---NECLQVLKLFLNPL 327

  Fly   380 ALEEQLSFERTLRKKAEKLNEKLSHQLMRPDSNHMVQE---KAMEG-------------GSQTNI 428
            :||...|....:::..:...|.:.      .||.:|.|   |.::|             |.|...
Mouse   328 SLEGAYSLIMAIKRNPKSRMEDID------ISNVLVSEQFVKVLDGVCAIHPQLDVVYKGLQGLS 386

  Fly   429 SREYVARNDVMPEVIKNSQSYRQS------HFNRLVNSAA--TSPEVTPRSEIVTLRKEQQLQRQ 485
            :::.::.......:|   |||.:.      .|.|.:|...  |.|....|..::           
Mouse   387 TKKSISLGTNPMRLI---QSYTEQKKISVVEFFRSLNPTGLMTMPVGDFRKAMI----------- 437

  Fly   486 QPPPMEVKHLSLEQQIRNLRDVQKKVDL-DVEEEEEEEEEEQQAEESQS 533
            |...:.:....:.:.|:.|.:.:..|:. .:|:|:..:..|.:.||.||
Mouse   438 QQSNILINRYQVRELIKKLDEKKGMVNFSSLEKEDLSKTVEPKPEELQS 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 47/215 (22%)
leucine-rich repeat 153..180 CDD:275381 10/31 (32%)
leucine-rich repeat 181..208 CDD:275381 5/26 (19%)
leucine-rich repeat 209..246 CDD:275381 6/36 (17%)
leucine-rich repeat 260..285 CDD:275381 5/35 (14%)
Lrrc74aNP_001182696.1 LRR_RI 73..333 CDD:393385 68/307 (22%)
leucine-rich repeat 148..176 CDD:275380 6/28 (21%)
leucine-rich repeat 177..204 CDD:275380 6/36 (17%)
leucine-rich repeat 205..232 CDD:275380 8/26 (31%)
leucine-rich repeat 233..257 CDD:275380 2/23 (9%)
leucine-rich repeat 261..284 CDD:275380 7/22 (32%)
leucine-rich repeat 285..313 CDD:275380 12/52 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.