DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and lrrc34

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001373409.1 Gene:lrrc34 / 556175 ZFINID:ZDB-GENE-091118-73 Length:410 Species:Danio rerio


Alignment Length:393 Identity:80/393 - (20%)
Similarity:151/393 - (38%) Gaps:106/393 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RYLELCRAKNLTP----VPEIRSKSNATTTFLELCGD-----KLAVSDWQLLTEALHYDLVLQQL 99
            |||.:| |:...|    |.|:...:.::...|:|.|:     :|...|..:||:.|..:..::.|
Zfish     7 RYLSVC-AELQQPTHASVLEVLGNNKSSDCCLKLAGNDQPGARLTDDDMLVLTKTLEGNSAIKGL 70

  Fly   100 VVRLRRTYPQTNIDPIDTEKRARLFRQRPVIYTRFIFNSLVQAIANCVSSNKNLSVLKLEGLPLQ 164
            .:|..          ..|:|.|                   ..||:.:..:|:|..|.|....::
Zfish    71 DLRYN----------CITDKGA-------------------VHIAHLIQDSKSLQSLDLMCNDIE 106

  Fly   165 DGYIETIAKALADNECLESVSFRKSNIGDKGCEVVCNTAKYLNRIEVFDLSECGLTSKGAEHVAD 229
            ....|.|||:|..|..|:::....:.||::|...:....:....:|..|:|:|.|.::.....|.
Zfish   107 ADGAEVIAKSLHKNITLKTLRMTGNKIGNQGAMQLATMLQINATLEEVDVSDCDLATQSVIAFAI 171

  Fly   230 MLKMQKITRFTEGWEKSLRYRSVDVN----------TIGGLRTVLLADNP---------EIGDVG 275
            :|...|            |..:::|:          |...:..:|:.:|.         ::.|.|
Zfish   172 VLMNNK------------RICAINVSRPLLFSLQEETTVHMAQMLVVNNTLKELHMGKHDMTDTG 224

  Fly   276 IRWITEVLKEDAWIKKIDMEGCGLTDIGANLILDCLELNTAI----TEFNVRNNEGISKFLQRSI 336
            :..:.|.||.:..::.:|:....:|..||..:.:.|:.|.::    ..||...:.|       :|
Zfish   225 VETLCEALKRNISLRYLDLCCNRITRDGAKHLSEVLKQNCSLEILDLSFNCIEDVG-------AI 282

  Fly   337 HDRLGCLPEEKQEPEYDLSCVNGLQSLPKNKKVTVSQLLSHTKALEEQLSFERTLRKKAEKLNEK 401
            |     |.|..:.|...|..:    |:..| |:....|||.:.|:               ::|..
Zfish   283 H-----LSEAIKLPHSKLKAL----SVTSN-KIRKGGLLSLSAAM---------------RVNSS 322

  Fly   402 LSH 404
            |:|
Zfish   323 LTH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 40/200 (20%)
leucine-rich repeat 153..180 CDD:275381 9/26 (35%)
leucine-rich repeat 181..208 CDD:275381 4/26 (15%)
leucine-rich repeat 209..246 CDD:275381 8/36 (22%)
leucine-rich repeat 260..285 CDD:275381 6/33 (18%)
lrrc34NP_001373409.1 RNA1 <21..>138 CDD:227563 30/145 (21%)
leucine-rich repeat 67..94 CDD:275381 7/55 (13%)
LRR_RI <95..332 CDD:423007 56/275 (20%)
leucine-rich repeat 95..122 CDD:275380 9/26 (35%)
leucine-rich repeat 123..150 CDD:275380 4/26 (15%)
leucine-rich repeat 151..178 CDD:275380 8/38 (21%)
leucine-rich repeat 179..202 CDD:275380 2/22 (9%)
leucine-rich repeat 210..237 CDD:275380 5/26 (19%)
leucine-rich repeat 238..265 CDD:275380 6/26 (23%)
leucine-rich repeat 266..292 CDD:275380 7/37 (19%)
leucine-rich repeat 323..344 CDD:275380 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.