DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and Lrrc34

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001038161.1 Gene:Lrrc34 / 499589 RGDID:1565052 Length:415 Species:Rattus norvegicus


Alignment Length:407 Identity:73/407 - (17%)
Similarity:145/407 - (35%) Gaps:110/407 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GDKLAVSDWQLLTEALHYDLVLQQLVVRLRRTYPQTNIDPIDTEKRARLFRQRP-VIYTRFIFNS 138
            |.::...|:.||::||.....:..:.||...      |..:.....|:|.:::| :.|...:||.
  Rat    55 GQRITSEDFWLLSKALRNHPCIGGVDVRYNL------IGDVGAYYAAKLLQKQPNITYLNLMFND 113

  Fly   139 L----VQAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKALADNECLESVSFRKSNIGDKGCEVV 199
            :    .:.||..:..||.|..|::.|..:::......|..|..|..||.:               
  Rat   114 IGPEGGELIAKALQKNKTLKYLRMTGNKIENTGGMLFAAMLQMNSSLEKL--------------- 163

  Fly   200 CNTAKYLNRIEVFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDVNTIGGLRTVL 264
                         ||.:|.            |.:|.:..|:....::...:.:::|     |.:|
  Rat   164 -------------DLGDCD------------LGLQSVIAFSTVLTQNKAIKGINLN-----RPIL 198

  Fly   265 LADNPE----IGDVGIRWITEVLKEDAWIKKIDMEGCGLTDIGANLILDCLELNTAITEFNVRNN 325
            ..:..|    ||.:.        |::..:.::.|...|:.:.|...:.:.|..|:.:        
  Rat   199 YGEQEESTVHIGHMS--------KQNHVLVELHMCKHGMKNYGIQQLCNALHSNSTL-------- 247

  Fly   326 EGISKFLQRSIHDRLGCLPEEKQEPEYDLSCVNGLQSLPKNKKVTVSQLLSHTKALEE-QLSFER 389
                ::|                    |:||    ..:.::..|.::.:|.....||. .|||.|
  Rat   248 ----RYL--------------------DVSC----NKITRDGMVFLADVLKSNSTLEVLDLSFNR 284

  Fly   390 TLRKKAEKLNEKLSHQLMRPDSNHMVQEKAMEGGSQTNISREYVARNDVMPEVIKNSQSYRQS-- 452
            .....|:.|:|.|:.......:..:|..| :||.....:|:. :..|.|:..:......:.:.  
  Rat   285 IENAGAKYLSETLTSHNRSLKALSVVSNK-IEGEGLVALSQS-MNTNLVLSNIYIWGNKFDEDTC 347

  Fly   453 -HFNRLVNSAATSPEVT 468
             .::.|:.|....||.|
  Rat   348 VAYSNLIESGRLKPENT 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 30/181 (17%)
leucine-rich repeat 153..180 CDD:275381 6/26 (23%)
leucine-rich repeat 181..208 CDD:275381 2/26 (8%)
leucine-rich repeat 209..246 CDD:275381 6/36 (17%)
leucine-rich repeat 260..285 CDD:275381 5/28 (18%)
Lrrc34NP_001038161.1 leucine-rich repeat 79..103 CDD:275380 5/29 (17%)
LRR_RI <98..347 CDD:238064 57/339 (17%)
leucine-rich repeat 104..131 CDD:275380 6/26 (23%)
leucine-rich repeat 132..159 CDD:275380 6/26 (23%)
leucine-rich repeat 160..195 CDD:275380 9/79 (11%)
leucine-rich repeat 219..246 CDD:275380 5/26 (19%)
LRR_8 245..314 CDD:290566 18/105 (17%)
LRR 1 246..272 6/61 (10%)
leucine-rich repeat 247..274 CDD:275380 6/62 (10%)
LRR 2 274..296 8/21 (38%)
leucine-rich repeat 275..294 CDD:275380 7/18 (39%)
leucine-rich repeat 304..325 CDD:275380 5/21 (24%)
leucine-rich repeat 332..353 CDD:275380 0/20 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.