DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and CG8197

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster


Alignment Length:268 Identity:58/268 - (21%)
Similarity:91/268 - (33%) Gaps:98/268 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LAVSDWQ--LLTEALHYDLVLQQLVVRLRRTYPQTNIDPIDTEKRARLFRQRPVIYTRFIFNSLV 140
            |.||:|.  ||.:.:...|.:..:.:||.|                         :.|..|    
  Fly    87 LVVSNWDAGLLKDFVRSLLPVWYIELRLMR-------------------------FPREFF---- 122

  Fly   141 QAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKALADNECLESVSFRKSNIGDKGCEVVCNTAKY 205
             .:....::..|:|.|.|||.||.|..:..:.:.|                      :|..|.:.
  Fly   123 -VMLRLNAAKMNVSQLSLEGTPLTDEDVRILREFL----------------------LVSKTLRR 164

  Fly   206 LNRIEVFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDVNTIGGLRTVLLADNPE 270
            ||      :|.|.||......:||            |..||...|.:..|.:.|:.  |..|..:
  Fly   165 LN------VSSCSLTQFNFALIAD------------GVYKSPGVRRLSANRLLGMS--LSLDTEK 209

  Fly   271 IGDVGIRWITEVLKEDA-WIKKIDMEGCGLTDIGANLILDCLELNTAITEFNVRNNEGISKFLQR 334
            |..|    ::.:|.::. |  .:.:|.|.||  ..::|        .|.|...|.|   |||.:.
  Fly   210 ISSV----LSSLLMQNTLW--ALSLEHCELT--AQDMI--------PIAEHLARTN---SKFRRL 255

  Fly   335 SIHDRLGC 342
                |:.|
  Fly   256 ----RIAC 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 38/178 (21%)
leucine-rich repeat 153..180 CDD:275381 9/26 (35%)
leucine-rich repeat 181..208 CDD:275381 3/26 (12%)
leucine-rich repeat 209..246 CDD:275381 7/36 (19%)
leucine-rich repeat 260..285 CDD:275381 5/24 (21%)
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 10/48 (21%)
LRR_RI 137..374 CDD:238064 44/188 (23%)
leucine-rich repeat 162..189 CDD:275381 11/44 (25%)
leucine-rich repeat 202..220 CDD:275380 5/23 (22%)
leucine-rich repeat 223..251 CDD:275380 10/42 (24%)
leucine-rich repeat 252..279 CDD:275380 3/12 (25%)
leucine-rich repeat 280..307 CDD:275380
leucine-rich repeat 308..335 CDD:275380
leucine-rich repeat 336..357 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.