DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and Lrrc31

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_017175099.1 Gene:Lrrc31 / 320352 MGIID:2443864 Length:515 Species:Mus musculus


Alignment Length:523 Identity:107/523 - (20%)
Similarity:187/523 - (35%) Gaps:139/523 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SDWQLLTEALHYDLVLQQLVVRLRRT------YPQTNIDPIDTEKRARL---FRQRPVIYTRFIF 136
            |||           .|::|..|...|      |..|.:|..:|.....|   ..:..|.:..|..
Mouse    34 SDW-----------FLRKLCGRAADTGLDLNSYGLTAVDVKETASILPLLSDLEELDVSWNDFAR 87

  Fly   137 NSLVQAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKALADNECLESVSFR-KSNIGDKGCEVVC 200
            .:|..........|| |.||:|....|....::|:..||.....||.:|.. .|.:|.| ...|.
Mouse    88 GALHMLTQQMHPVNK-LKVLRLSSCRLTTEDVQTLGGALEMTPELEELSLSWNSQVGGK-LPRVL 150

  Fly   201 NTAKYLNRIEVFDLSECGLTSKGAEHVADML-KMQKITRF---------------TEGW------ 243
            :|.:..::|...:|.:|.|||:....|..:| |:|.:..|               .:|.      
Mouse   151 HTFQQGSKIRTLELVDCALTSQDGVFVGHLLPKLQSLQVFDLSNNRNIGSCLEVIAQGLRSASGL 215

  Fly   244 -----------EKSLR-----YRSVDVNTIGGLRTVLLADNPEIGDVGIRWITEVLKEDAWIKKI 292
                       :||:|     :.|:||     ||.:.|:.|.|:|. |...:...|.....::.:
Mouse   216 KELKLRSCGLSQKSIRLLDGVFASLDV-----LRILDLSCNKELGG-GFEDVPAQLASLKHLEVL 274

  Fly   293 DMEGCGLTDIGANLILDCLELNTAITEFNVRNNEGISKFLQRSIHDRLGCLPEEKQEPEYDLSCV 357
            |:..|.||......:...:.|.:.:.|.::.:|..:.. ...::..||..||             
Mouse   275 DLHQCSLTAGDVTSLTQIIPLLSNLEELDLSSNRDVGG-SSENLLCRLRFLP------------- 325

  Fly   358 NGLQSLPKNKKVTVSQLLS-------HTKALE-EQLSFERTLRKKAEKLNEKLSH-----QLMRP 409
             .|:||..|.....|:..:       :..||| ..||:.:.:....|.|.:.| |     :::|.
Mouse   326 -ALKSLLINSCALQSEAFAALADASVYLPALEILNLSWNKCVGGNLELLQQTL-HLSRLLRVLRL 388

  Fly   410 DSNHMVQE------KAMEGGSQTNISREYVARND---------------VMPEVIKNSQSYRQSH 453
            .|..:|.|      ..::.|....:.:..::.||               .:.|:.:...|.|.|.
Mouse   389 SSCSLVTEDVVLLASVIQSGHLATLQKLDLSYNDGICDAGWAILCQNLCFLKELTELDISLRPSS 453

  Fly   454 -------FNRLVNSAATSPEVTPRSEIVTLRKEQQLQRQQPPPMEVKHLSLEQQIRNLRDVQKKV 511
                   |:.|:.:....|.:|          |.:::|...|.::.:.|....|     |.|:::
Mouse   454 SQDCGQWFSHLLCAVTQLPVIT----------EIEMRRWVIPALQERELDCFTQ-----DHQREI 503

  Fly   512 DLD 514
            ..|
Mouse   504 RFD 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 49/216 (23%)
leucine-rich repeat 153..180 CDD:275381 8/26 (31%)
leucine-rich repeat 181..208 CDD:275381 8/27 (30%)
leucine-rich repeat 209..246 CDD:275381 12/69 (17%)
leucine-rich repeat 260..285 CDD:275381 8/24 (33%)
Lrrc31XP_017175099.1 leucine-rich repeat 48..74 CDD:275380 6/25 (24%)
LRR_RI 64..331 CDD:393385 62/289 (21%)
leucine-rich repeat 75..95 CDD:275380 3/19 (16%)
leucine-rich repeat 103..130 CDD:275380 8/26 (31%)
leucine-rich repeat 131..186 CDD:275380 17/55 (31%)
leucine-rich repeat 187..211 CDD:275380 2/23 (9%)
leucine-rich repeat 215..242 CDD:275380 4/26 (15%)
leucine-rich repeat 243..270 CDD:275380 8/27 (30%)
leucine-rich repeat 271..298 CDD:275380 5/26 (19%)
leucine-rich repeat 299..326 CDD:275380 6/41 (15%)
leucine-rich repeat 327..354 CDD:275380 5/26 (19%)
leucine-rich repeat 413..441 CDD:275380 2/27 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.