DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and Nlrp9

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001162620.1 Gene:Nlrp9 / 292577 RGDID:1308981 Length:1003 Species:Rattus norvegicus


Alignment Length:430 Identity:93/430 - (21%)
Similarity:165/430 - (38%) Gaps:88/430 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKKSSKSRSFHFR-----YLELCRAKNLTPVPEIRSKSNATTTFLELCGDKLAVSDWQLLTEALH 91
            ::||||.:..|..     :||:...:........:.|.||...:.:||  .:.|:...|..::.:
  Rat   580 LQKSSKLKKLHLHIQKRVFLEIHDPEYSDSETFTQDKKNAAEYWKKLC--HIFVNLHVLDLDSCN 642

  Fly    92 YDLVLQQLVVRLRRTYPQTNIDPIDTEKRARLFRQRPVIYTRF----IFNSLVQAIANCVSSNKN 152
            ::   :|::..|......:...|:...|...|...   ..|.|    :|::|:|.        .:
  Rat   643 FN---KQVIEELCNVLSPSPKIPLMAFKLESLLCS---FMTNFGDGSLFHTLLQL--------PH 693

  Fly   153 LSVLKLEGLPLQDGYIETIAKALADNEC-LESVSFRKSNIGDKGCEVVCNTAKYLNRIEVFDLSE 216
            |..|.|.|..|.:..||.:..||..:.| :|.:...|.:|..:.|.::. |:...::::...|.|
  Rat   694 LKYLNLYGTNLSNSRIENLCSALRRSTCKVEELLLGKCDISSEACGIIA-TSLMNSKVKHLSLVE 757

  Fly   217 CGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDVNTIGGLRTVLLADNP----EIG----- 272
            ..|.:||...:.:|||.......|    ..|.|..:.....|.|...|:::..    ::|     
  Rat   758 NPLKNKGVMSLCEMLKDPSCVLET----LMLSYCCLTFIACGHLYEALVSNKHLSLLDLGSNFLE 818

  Fly   273 DVGIRWITEVLKE-DAWIKKIDMEGCGLTDIGANLILDCLELNTAITEFNVRNNEGISKFLQRSI 336
            |.|:..:.|.||: :..:|::.:.||.||.       :|.|..:|:...|  ||....|.....|
  Rat   819 DTGVNLLCEALKDPNCILKELWLSGCFLTS-------ECCEEISAVLTCN--NNLKTLKLGNNDI 874

  Fly   337 HDR-LGCLPEEKQEPEYDLSC-------------------------VNGL----QSLPKNKKVTV 371
            .|. :..|.|....|...|.|                         :|.|    ::|..:..|.:
  Rat   875 EDTGVKHLCEALSHPNCKLECLGLDLCKFTSDCCEDLASALTTCKTLNSLNLDWKTLEHSGVVAL 939

  Fly   372 SQLLSHTKALEEQLSFER--------TLRKKAEKLNEKLS 403
            .:.|:|.|...:.|..::        ||.:..||.|..||
  Rat   940 CEALNHKKCNLKMLGLDKSAFSVESQTLLQAVEKKNNNLS 979

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 43/188 (23%)
leucine-rich repeat 153..180 CDD:275381 9/26 (35%)
leucine-rich repeat 181..208 CDD:275381 5/26 (19%)
leucine-rich repeat 209..246 CDD:275381 9/36 (25%)
leucine-rich repeat 260..285 CDD:275381 7/33 (21%)
Nlrp9NP_001162620.1 Pyrin_NALPs 9..90 CDD:260032
YlqF_related_GTPase 144..308 CDD:424112
NOD2_WH 385..>430 CDD:407651
NLRC4_HD2 440..555 CDD:407648
leucine-rich repeat 633..667 CDD:275381 4/36 (11%)
leucine-rich repeat 668..687 CDD:275381 4/21 (19%)
LRR_RI 691..956 CDD:423007 62/286 (22%)
leucine-rich repeat 694..722 CDD:275380 9/27 (33%)
leucine-rich repeat 723..749 CDD:275380 5/26 (19%)
leucine-rich repeat 750..778 CDD:275380 8/27 (30%)
leucine-rich repeat 779..806 CDD:275380 6/30 (20%)
leucine-rich repeat 807..834 CDD:275380 6/26 (23%)
leucine-rich repeat 836..863 CDD:275380 9/35 (26%)
leucine-rich repeat 893..920 CDD:275381 2/26 (8%)
leucine-rich repeat 921..949 CDD:275381 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.