Sequence 1: | NP_650378.1 | Gene: | CG7886 / 41775 | FlyBaseID: | FBgn0038248 | Length: | 818 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038953498.1 | Gene: | Nod2 / 291912 | RGDID: | 1306368 | Length: | 1012 | Species: | Rattus norvegicus |
Alignment Length: | 335 | Identity: | 67/335 - (20%) |
---|---|---|---|
Similarity: | 130/335 - (38%) | Gaps: | 70/335 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 SVPPLVKKSSKSRSFHFRYLELCRAKNLTPVPEIRSKSNATTTF----LELCGDKLAVSDWQLLT 87
Fly 88 EALHY---------------DLVLQQLV--------VRLRRTYPQTNIDPIDTEKRARLF----- 124
Fly 125 ----RQRPVIYTRFIFNSLVQAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKALADNECLESVS 185
Fly 186 FRKSNIGDKGCEVVCNTAKYLNRIEVFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYR 250
Fly 251 SVDVNTIGGLRTVLLADNPEIGDVGIRWITEVLKEDAWIKKIDMEGCGLTDIGANLILDCLELNT 315
Fly 316 AITEFNVRNN 325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7886 | NP_650378.1 | LRR_RI | <142..320 | CDD:238064 | 39/177 (22%) |
leucine-rich repeat | 153..180 | CDD:275381 | 5/26 (19%) | ||
leucine-rich repeat | 181..208 | CDD:275381 | 6/26 (23%) | ||
leucine-rich repeat | 209..246 | CDD:275381 | 8/36 (22%) | ||
leucine-rich repeat | 260..285 | CDD:275381 | 8/24 (33%) | ||
Nod2 | XP_038953498.1 | DD | 7..87 | CDD:417479 | |
DD | 107..186 | CDD:417479 | |||
NACHT | 266..436 | CDD:399032 | |||
NOD2_WH | 518..574 | CDD:407651 | |||
NLRC4_HD2 | 576..729 | CDD:407648 | 10/37 (27%) | ||
LRR_RI | <752..984 | CDD:423007 | 51/263 (19%) | ||
leucine-rich repeat | 786..816 | CDD:275380 | 6/37 (16%) | ||
leucine-rich repeat | 817..844 | CDD:275380 | 2/26 (8%) | ||
leucine-rich repeat | 845..872 | CDD:275380 | 5/26 (19%) | ||
leucine-rich repeat | 873..900 | CDD:275380 | 6/26 (23%) | ||
leucine-rich repeat | 901..928 | CDD:275380 | 8/49 (16%) | ||
leucine-rich repeat | 929..953 | CDD:275380 | 8/24 (33%) | ||
leucine-rich repeat | 957..978 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 979..1006 | CDD:275380 | 5/15 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |