| Sequence 1: | NP_650378.1 | Gene: | CG7886 / 41775 | FlyBaseID: | FBgn0038248 | Length: | 818 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001342080.1 | Gene: | Nlrp4b / 210045 | MGIID: | 3056570 | Length: | 863 | Species: | Mus musculus |
| Alignment Length: | 265 | Identity: | 51/265 - (19%) |
|---|---|---|---|
| Similarity: | 102/265 - (38%) | Gaps: | 76/265 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 150 NKNLSVLKLEGLPLQDGYIETIAKALADNEC---------------------------LESVSFR 187
Fly 188 KSNIGDKGCEVVCNTAKYLNR----IEVFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLR 248
Fly 249 YRSVDVNTIGGLRTVLLADNPEIGDVGIRWITEVLK-EDAWIKKIDMEGCGLTDIGANLILDCLE 312
Fly 313 LNTAITEFN-------VRNNEGISKF--LQRSIHDRLGCLPEEK-QEPEYDLSCVNGLQS-LPKN 366
Fly 367 KKVTV 371 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7886 | NP_650378.1 | LRR_RI | <142..320 | CDD:238064 | 38/201 (19%) |
| leucine-rich repeat | 153..180 | CDD:275381 | 3/26 (12%) | ||
| leucine-rich repeat | 181..208 | CDD:275381 | 6/26 (23%) | ||
| leucine-rich repeat | 209..246 | CDD:275381 | 7/36 (19%) | ||
| leucine-rich repeat | 260..285 | CDD:275381 | 3/25 (12%) | ||
| Nlrp4b | NP_001342080.1 | Pyrin_NALPs | 10..93 | CDD:260032 | |
| NACHT | 145..311 | CDD:310381 | |||
| LRR_RI | 601..834 | CDD:330982 | 45/238 (19%) | ||
| LRR 1 | 618..643 | 4/14 (29%) | |||
| LRR 2 | 683..706 | 4/22 (18%) | |||
| leucine-rich repeat | 686..709 | CDD:275380 | 5/25 (20%) | ||
| leucine-rich repeat | 715..742 | CDD:275380 | 7/36 (19%) | ||
| LRR 3 | 717..740 | 6/32 (19%) | |||
| LRR 4 | 741..763 | 8/35 (23%) | |||
| LRR 5 | 765..782 | 3/16 (19%) | |||
| leucine-rich repeat | 772..799 | CDD:275380 | 9/32 (28%) | ||
| LRR 6 | 797..824 | 4/26 (15%) | |||
| leucine-rich repeat | 800..821 | CDD:275380 | 4/20 (20%) | ||
| LRR 7 | 843..863 | 4/17 (24%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||