DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and LRRC34

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001166250.1 Gene:LRRC34 / 151827 HGNCID:28408 Length:464 Species:Homo sapiens


Alignment Length:445 Identity:98/445 - (22%)
Similarity:161/445 - (36%) Gaps:120/445 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GHSGEVARKP------NTVVVSVPP---LVKKSSKSRSFHFRYLELCRAKN----------LTPV 57
            |.|.|.||.|      .:...|.|.   .|::.|........|..||..|:          |..|
Human    15 GSSREAARAPARSPAWASTQASTPGAALAVQRESPESGLQKHYSNLCMEKSQKINPFILHILQEV 79

  Fly    58 PEIRSKSNATTTFLELCG-------DKLAVSDWQLLTEALHYDLVLQQLVVRLRRTYPQTNIDPI 115
            .|...|..|....|.:.|       :::...|:.:|::.|...|.:..|.|....      :..:
Human    80 DEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILKNCLYINGLDVGYNL------LCDV 138

  Fly   116 DTEKRARLF-RQRPVIYTRFIFNSL----VQAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKAL 175
            .....|:|. :|..:||...:||.:    .:.||..:..|:.|..|::.|..:::......|..|
Human   139 GAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRTLKYLRMTGNKIENKGGMFFAAML 203

  Fly   176 ADNECLESVSFRKSNIG--DKGCEVVCNTAKYLNR---IEVFDLSECGLTSKGAE---HVADMLK 232
            ..|..||     |.::|  |.|.:.|...|..|.:   |:..:|:...|.|:..|   ||..|||
Human   204 QINSSLE-----KLDLGDCDLGMQSVIAFATVLTQNQAIKAINLNRPILYSEQEESTVHVGRMLK 263

  Fly   233 ---------MQKITRFTEGWEK---------SLRYRSVDVNTIGGLRTVLLADNPEIGDVGIRWI 279
                     |.|......|.::         ||||..|..|              :|...|:.::
Human   264 ENHCLVALHMCKHDIKNSGIQQLCDALYLNSSLRYLDVSCN--------------KITHDGMVYL 314

  Fly   280 TEVLKEDAWIKKIDMEGCGLTDIGANLILDCL-ELNTAITEFNVRNN----EGI----------- 328
            .:|||.:..::.||:....:.:.|||.:.:.| ..|.::...:|.:|    ||:           
Human   315 ADVLKSNTTLEVIDLSFNRIENAGANYLSETLTSHNRSLKALSVVSNNIEGEGLVALSQSMKTNL 379

  Fly   329 ---------SKF-----LQRSIHDRLGCLPEEKQEPE--------YDLSCVNGLQ 361
                     :||     :..|...::|||..:..:.|        |.....|||:
Human   380 TFSHIYIWGNKFDEATCIAYSDLIQMGCLKPDNTDVEPFVVDGRVYLAEVSNGLK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 49/204 (24%)
leucine-rich repeat 153..180 CDD:275381 6/26 (23%)
leucine-rich repeat 181..208 CDD:275381 9/28 (32%)
leucine-rich repeat 209..246 CDD:275381 13/57 (23%)
leucine-rich repeat 260..285 CDD:275381 4/24 (17%)
LRRC34NP_001166250.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 9/32 (28%)
LRR_RI <147..396 CDD:330982 60/267 (22%)
leucine-rich repeat 153..180 CDD:275380 7/26 (27%)
leucine-rich repeat 181..208 CDD:275380 6/26 (23%)
leucine-rich repeat 209..244 CDD:275380 11/39 (28%)
leucine-rich repeat 268..295 CDD:275380 3/26 (12%)
LRR 1 295..315 8/33 (24%)
leucine-rich repeat 296..323 CDD:275380 10/40 (25%)
LRR 2 323..345 5/21 (24%)
leucine-rich repeat 324..352 CDD:275380 7/27 (26%)
leucine-rich repeat 353..374 CDD:275380 4/20 (20%)
leucine-rich repeat 375..402 CDD:275380 3/26 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.