DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and LRRC71

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_005244983.1 Gene:LRRC71 / 149499 HGNCID:26556 Length:560 Species:Homo sapiens


Alignment Length:512 Identity:101/512 - (19%)
Similarity:187/512 - (36%) Gaps:153/512 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GEVA--RKPNTVVVSVPPLVKKSSKSRS-------FHFRYLELCRAKNLTPVPEIRSKSNATTTF 70
            ||.|  .||.||   :||:.::..||..       ....:.|||.....|..|::.::......|
Human    30 GERAAKEKPATV---LPPVGEEEPKSPEEYQCSGVLETDFAELCTRWGYTDFPKVVNRPRPHPPF 91

  Fly    71 LELC--GDKLAVSDWQLLTE-ALHYDLVLQQLVVRLRRTYPQTNIDPIDTEKRARLFRQRPVIYT 132
            :...  .:|..:.|.:|... :|:   .|:...|..|.|. |..::..|::....::.:...:..
Human    92 VPSASLSEKATLDDPRLSGSCSLN---SLESKYVFFRPTI-QVELEQEDSKSVKEIYIRGWKVEE 152

  Fly   133 RFI---------------------------FNSLVQAIANCVSSNKNLSVLKLEGLPLQDGYIET 170
            |.:                           ..:.::.:..|.|:.:.:|   |||.||.:   ::
Human   153 RILGVFSKCLPPLTQLQAINLWKVGLTDKTLTTFIELLPLCSSTLRKVS---LEGNPLPE---QS 211

  Fly   171 IAKALADNECLESVSFRKSNIGDKGCEVV---CNTAKYLNRIEV-FDLSECGLTSKGAEHVADML 231
            ..|.:|.:..:..:|.|.:||.|:|.:::   .:|....||..| .:|....:..:||.::||.|
Human   212 YHKLMALDSTIAHLSLRNNNIDDRGAQLLGQALSTLHSCNRTLVSLNLGFNHIGDEGAGYIADGL 276

  Fly   232 KMQKITRFTEGWEKSLRYRSVDVNTI---GGLRTVLLADNPEIGDVGIRWITEVLKEDAWI---- 289
            ::          .:||.:.|:..|.|   |.|:...:....|:..      |||::....:    
Human   277 RL----------NRSLLWLSLAHNRIQDKGALKLAEVLRAFELTH------TEVVERRRLLLEKG 325

  Fly   290 ---------------KKIDMEGCGLTDIGANLILDCLELNTAITEFNVRNNEGISKFLQRS---- 335
                           .|.|.|...:..|..:.::|    .|..|: .::..:|:.|..::|    
Human   326 TQERSRSPSSSRHGDSKTDREKSQMVGISNSALVD----KTDKTQ-TMKTPKGLGKKKEKSWELA 385

  Fly   336 -IHDRLGCLPEEKQEPEYDLSCVNGLQSLPKNK--------KVTV-SQLLSHTKALE-------- 382
             ..::||    ..|.|         .|..||.:        |||: .|..|..|.::        
Human   386 KKEEKLG----SGQSP---------TQGTPKKEDATKAGKGKVTIPEQKPSRAKGIKIGSREKRS 437

  Fly   383 -----EQLSFERTLRKKAEKLNEKLSH---QLMRPDSN---HM------VQEKAMEG 422
                 |||..|.|  :....|.|.:.|   ::..|.:.   |:      :.|..:||
Human   438 ILLESEQLVVEAT--EVVNPLLEPVEHRDGKVFMPGNKVLLHLNLIRNRITEVGLEG 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 44/203 (22%)
leucine-rich repeat 153..180 CDD:275381 8/26 (31%)
leucine-rich repeat 181..208 CDD:275381 7/29 (24%)
leucine-rich repeat 209..246 CDD:275381 7/37 (19%)
leucine-rich repeat 260..285 CDD:275381 5/24 (21%)
LRRC71XP_005244983.1 LRR_RI <161..308 CDD:238064 33/162 (20%)
leucine-rich repeat 168..196 CDD:275380 1/27 (4%)
leucine-rich repeat 197..217 CDD:275380 7/25 (28%)
leucine-rich repeat 218..243 CDD:275380 6/24 (25%)
leucine-rich repeat 254..281 CDD:275380 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.