| Sequence 1: | NP_650378.1 | Gene: | CG7886 / 41775 | FlyBaseID: | FBgn0038248 | Length: | 818 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_604393.2 | Gene: | NLRP4 / 147945 | HGNCID: | 22943 | Length: | 994 | Species: | Homo sapiens |
| Alignment Length: | 344 | Identity: | 70/344 - (20%) |
|---|---|---|---|
| Similarity: | 121/344 - (35%) | Gaps: | 128/344 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 40 SFHFRYLELCRAKNLTPVPEIRSKSNATTTFLELCG---------DKLAVSDWQ------LLTEA 89
Fly 90 LHYDLVLQQL---VVRLRR----------TYPQTNI----------DPIDTEKRARLFRQRP--- 128
Fly 129 --------------------------VIYTRFIFNSLVQAIANCVSS----NKNLSVLKLEGLPL 163
Fly 164 QDGYIETIAKALADNE-CLESVSFRK----------------------------SNIGDKGCEVV 199
Fly 200 CNTAKYLN-RIEVFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDVNTIGGLRTV 263
Fly 264 LLAD---NPE--IGDVGIR 277 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7886 | NP_650378.1 | LRR_RI | <142..320 | CDD:238064 | 40/175 (23%) |
| leucine-rich repeat | 153..180 | CDD:275381 | 7/27 (26%) | ||
| leucine-rich repeat | 181..208 | CDD:275381 | 8/55 (15%) | ||
| leucine-rich repeat | 209..246 | CDD:275381 | 10/36 (28%) | ||
| leucine-rich repeat | 260..285 | CDD:275381 | 6/23 (26%) | ||
| NLRP4 | NP_604393.2 | Pyrin_NALPs | 11..92 | CDD:260032 | |
| AAA | 147..279 | CDD:214640 | |||
| NACHT | 149..318 | CDD:283404 | |||
| CS_ACL-C_CCL | 512..>570 | CDD:294291 | |||
| LRR_RI | <630..733 | CDD:238064 | 21/107 (20%) | ||
| LRR 1 | 637..660 | 6/34 (18%) | |||
| leucine-rich repeat | 640..668 | CDD:275380 | 5/39 (13%) | ||
| leucine-rich repeat | 669..695 | CDD:275380 | 7/25 (28%) | ||
| leucine-rich repeat | 696..724 | CDD:275380 | 6/27 (22%) | ||
| LRR 2 | 698..721 | 3/22 (14%) | |||
| LRR 3 | 722..745 | 5/22 (23%) | |||
| LRR_RI | 724..957 | CDD:238064 | 48/242 (20%) | ||
| leucine-rich repeat | 725..752 | CDD:275380 | 6/26 (23%) | ||
| LRR 4 | 750..777 | 0/26 (0%) | |||
| leucine-rich repeat | 753..780 | CDD:275380 | 0/26 (0%) | ||
| leucine-rich repeat | 781..808 | CDD:275380 | 5/26 (19%) | ||
| LRR 5 | 806..833 | 9/26 (35%) | |||
| leucine-rich repeat | 809..833 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 838..865 | CDD:275380 | 3/26 (12%) | ||
| LRR 6 | 863..886 | 4/22 (18%) | |||
| leucine-rich repeat | 895..922 | CDD:275381 | 10/36 (28%) | ||
| LRR 7 | 920..943 | 6/22 (27%) | |||
| LRR 8 | 949..972 | 3/10 (30%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||