DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and LRRC74A

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_011534781.1 Gene:LRRC74A / 145497 HGNCID:23346 Length:529 Species:Homo sapiens


Alignment Length:421 Identity:82/421 - (19%)
Similarity:155/421 - (36%) Gaps:120/421 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 QAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKALADNECLESVSFRKSNIGDKGCEVV------ 199
            :|||..:.||..::.|:||...:.:..:.::.:.|.:|..|:.::...:::|.:|..::      
Human   139 KAIAIALVSNMAVTKLELEDNCIMEEGVLSLVEMLQENYYLQEMNISNNHLGLEGARIISDFFER 203

  Fly   200 -----------------------CNTAKYLNRIEVFDLSECGLTSKGAEHVADMLKMQ-KITRFT 240
                                   |.......:|:..|||....:..|.||:..||.:. .:|...
Human   204 NSSSIWSLELSGNDFKEDSAALLCQALSTNYQIKKLDLSHNQFSDVGGEHLGQMLAINVGLTSLD 268

  Fly   241 EGWEKSLRYRSVDVNTIGGLRTVLLADNPEIGDVGIRWITEVLKEDAWIKKIDMEGCGLTDIGAN 305
            ..|.        :.:|.|   .|.|.:.              |:.:..:.|:|:...|..:..|.
Human   269 LSWN--------NFHTRG---AVALCNG--------------LRGNVTLTKLDLSMNGFGNEVAL 308

  Fly   306 LILDCLELNTAITEFNVR----NNEGISKFLQRSIHDRLGCLPEEKQEPEYDLSCVNGLQSLPKN 366
            .:.:.|.||..:...::.    .|||.||..:                         ||:|   |
Human   309 ALGEVLRLNRCLVYLDIGGNDIGNEGASKISK-------------------------GLES---N 345

  Fly   367 KKVTVSQL----LSHTKALEEQLSFERTLRKKAEKL---NEKLSHQLMRP-DSNHMVQE------ 417
            :.:.|.:|    ::...|:...|:.:|..:.:.|:|   |..:|.|.|:. |..:.|..      
Human   346 ESLRVLKLFLNPINMDGAILLILAIKRNPKSRMEELDISNVLVSEQFMKTLDGVYAVHPQLDVVF 410

  Fly   418 KAMEGGSQTNISREYVARNDVMPEVIKNSQSYRQSHFNRLVN-SAATSPEVTPRSEIVTLRKEQQ 481
            ||::|.|.....  ::..|.     :|..|||...|...:|: ..:.:|..|.:..:...:|...
Human   411 KAVQGLSPKKTI--FLLTNP-----MKLIQSYADQHKITIVDFFKSLNPTGTMKMSVDEFQKVMI 468

  Fly   482 LQRQQPPPMEVKHLSLEQQIRNLRDVQKKVD 512
            .|.:.|         |.|.  .:|:|.||:|
Human   469 EQNKVP---------LNQY--QVREVIKKLD 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 37/207 (18%)
leucine-rich repeat 153..180 CDD:275381 5/26 (19%)
leucine-rich repeat 181..208 CDD:275381 4/55 (7%)
leucine-rich repeat 209..246 CDD:275381 11/37 (30%)
leucine-rich repeat 260..285 CDD:275381 3/24 (13%)
LRRC74AXP_011534781.1 LRR_RI 128..384 CDD:330982 53/297 (18%)
leucine-rich repeat 152..174 CDD:275380 3/21 (14%)
leucine-rich repeat 179..207 CDD:275380 3/27 (11%)
leucine-rich repeat 208..235 CDD:275380 1/26 (4%)
leucine-rich repeat 236..259 CDD:275380 8/22 (36%)
leucine-rich repeat 264..291 CDD:275380 7/51 (14%)
leucine-rich repeat 292..319 CDD:275380 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.