DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and nlrc5

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001373199.1 Gene:nlrc5 / 100535184 ZFINID:ZDB-GENE-080429-2 Length:1746 Species:Danio rerio


Alignment Length:417 Identity:82/417 - (19%)
Similarity:141/417 - (33%) Gaps:107/417 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVSRVTMMRKGHSGEVARK-----PNTVV---VSVPPLVKKSSKSRSFHFRYLELCRAKNLTPVP 58
            ::..:|:..||.:.|....     |||..   :|:..||.....:..|         .|....||
Zfish  1376 NLRNITLDLKGAAEEEVETLAEALPNTPAFESLSLSQLVLSDRGATLF---------GKAFQNVP 1431

  Fly    59 EIRSKSNATTTFLELCGDKLAVSDWQ---------------LLTEALHYDLVLQQLVVRLRRTYP 108
            .::|.|            .|..|.|.               ||||.....:||.|..:.:.    
Zfish  1432 NLKSFS------------MLQCSGWTAARGCDLVRGLMQCVLLTEIRLESVVLDQEGINIL---- 1480

  Fly   109 QTNIDPIDTEKRARLFRQRPVIYTRFIFNSLVQAIANCVSSNKNLSVLKLEGLPLQDG------- 166
            ...:..:.:.:|..|.....|....|:..:.:..:.......|.:..::||...:.||       
Zfish  1481 AQGLSRLASLRRLSLNNITVVTSETFVNGTGILCLLASFKGFKQMEEIELESWRMGDGGTNELVK 1545

  Fly   167 YI---------------------ETIAKALADNECLESVSFRKSNIGDKGCEVVCNTAKYLNRIE 210
            ||                     |.:..||:....|:.:...|:.:|......:......|.::.
Zfish  1546 YIPSWTGLVKISLSENIVTDQAGEKLLTALSHCRALQQLKLSKNKLGQASAAKLAKILPLLPQLS 1610

  Fly   211 VFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDVNTIGGLRTVLLADNPEIGDVG 275
            ..:|||.....:|:..:.:.|...|..       |.|...||:.:.:.|:.: .|...|.|.||.
Zfish  1611 ELNLSENQFGPQGSSVLCEGLVSMKAL-------KKLHLTSVESSDLVGVAS-SLKHCPSIEDVS 1667

  Fly   276 IRW----------ITEVLKEDAWIKKIDMEGCGLTDIGANLILDCLELNTAITEFNVRNNEGISK 330
            :.|          :.|:|.....:|::|:|...:|..||.||..||.|..:|....:..| .|:|
Zfish  1668 LSWNGCGDSLARTLAEILPLCTKLKRLDLEANNITTAGATLIAKCLPLCPSIEVIRLWRN-SIAK 1731

  Fly   331 FLQRSIHDRLGCLPEEKQEPEYDLSCV 357
            .            .|..::|:.:.|.|
Zfish  1732 D------------DENLKDPKLNFSSV 1746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 45/215 (21%)
leucine-rich repeat 153..180 CDD:275381 9/54 (17%)
leucine-rich repeat 181..208 CDD:275381 4/26 (15%)
leucine-rich repeat 209..246 CDD:275381 6/36 (17%)
leucine-rich repeat 260..285 CDD:275381 8/34 (24%)
nlrc5NP_001373199.1 COG5635 <149..>525 CDD:227922
NACHT 199..374 CDD:399032
NLRC4_HD2 516..634 CDD:407648
LRR_RI <706..887 CDD:423007
LRR_RI 885..>1143 CDD:423007
LRR_RI 1086..>1289 CDD:423007
leucine-rich repeat 1467..1489 CDD:275380 3/25 (12%)
LRR_RI <1473..1729 CDD:423007 51/268 (19%)
leucine-rich repeat 1490..1511 CDD:275380 4/20 (20%)
leucine-rich repeat 1525..1547 CDD:275380 4/21 (19%)
leucine-rich repeat 1553..1580 CDD:275380 3/26 (12%)
leucine-rich repeat 1581..1608 CDD:275380 4/26 (15%)
leucine-rich repeat 1609..1636 CDD:275380 5/26 (19%)
leucine-rich repeat 1663..1690 CDD:275380 6/26 (23%)
leucine-rich repeat 1691..1718 CDD:275380 11/26 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.