DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and Rnh1

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001257691.1 Gene:Rnh1 / 100360501 RGDID:621398 Length:492 Species:Rattus norvegicus


Alignment Length:189 Identity:46/189 - (24%)
Similarity:78/189 - (41%) Gaps:38/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 VLKLEGLPLQDGYIETIAKALADNECLESVSFRKSNIGDKGCEVVCN-----TAKYLNRIEVFDL 214
            |::|:...|.:...:.|..|:..|..|..:|.|.:.:||.|..:|..     |.|    |:...|
  Rat    63 VVRLDDCGLTEVRCKDIRSAIQANPALTELSLRTNELGDAGVGLVLQGLQNPTCK----IQKLSL 123

  Fly   215 SECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDVNTIGGLRTVLLADNPEIGDVGIRWI 279
            ..|.||..|...:.|:|:                       ::..||.:.|.||| :||.|::.:
  Rat   124 QNCSLTEAGCGVLPDVLR-----------------------SLSTLRELHLNDNP-LGDEGLKLL 164

  Fly   280 TEVLKE-DAWIKKIDMEGCGLTDIGANLILDCLELNTAITEFNVRNNEGISKFLQRSIH 337
            .|.|:: ...::|:.:|.|.||......:...|.:.....|..:.||:    |.:..||
  Rat   165 CEGLRDPQCRLEKLQLEYCNLTATSCEPLASVLRVKPDFKELVLSNND----FHEAGIH 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 40/170 (24%)
leucine-rich repeat 153..180 CDD:275381 6/24 (25%)
leucine-rich repeat 181..208 CDD:275381 9/31 (29%)
leucine-rich repeat 209..246 CDD:275381 8/36 (22%)
leucine-rich repeat 260..285 CDD:275381 11/24 (46%)
Rnh1NP_001257691.1 LRR_RI 37..356 CDD:238064 46/189 (24%)
leucine-rich repeat 38..60 CDD:275380
LRR <46..361 CDD:227223 46/189 (24%)
leucine-rich repeat 61..88 CDD:275380 6/24 (25%)
leucine-rich repeat 89..113 CDD:275380 7/23 (30%)
leucine-rich repeat 118..145 CDD:275380 8/49 (16%)
leucine-rich repeat 146..174 CDD:275380 11/28 (39%)
leucine-rich repeat 175..202 CDD:275380 6/26 (23%)
leucine-rich repeat 203..231 CDD:275380 6/21 (29%)
leucine-rich repeat 232..259 CDD:275380
leucine-rich repeat 260..288 CDD:275380
leucine-rich repeat 289..309 CDD:275380
leucine-rich repeat 317..336 CDD:275380
LRR_RI 318..>465 CDD:238064
leucine-rich repeat 374..402 CDD:275380
leucine-rich repeat 403..430 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.