DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7886 and tcte1

DIOPT Version :9

Sequence 1:NP_650378.1 Gene:CG7886 / 41775 FlyBaseID:FBgn0038248 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_009293283.1 Gene:tcte1 / 100331698 ZFINID:ZDB-GENE-120406-12 Length:450 Species:Danio rerio


Alignment Length:239 Identity:55/239 - (23%)
Similarity:99/239 - (41%) Gaps:45/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 QAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKALADNECLESVSFRKSNIGDKGCEVVCNTAKY 205
            :::|..::|.|.|.|.::....:.|.....|...|.|:..|:.:.|..::|.|:|...:   ||.
Zfish   232 ESLAKALNSCKTLQVFRIHRSKVDDEKCCVIVNHLLDHPSLQELDFSHNHISDRGARAI---AKL 293

  Fly   206 LNRIEVFDLSECG--LTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDVNTIGGLRTVLLADN 268
            |||.::..|..|.  :...||:.:|..|...                    ||:..|...|    
Zfish   294 LNRSQLKTLIVCNNQIRGAGAQALAHALAKN--------------------NTLTSLNLRL---- 334

  Fly   269 PEIGDVGIRWITEVLKEDAWIKKIDMEGCGLTDIGANLILDCLELNTAITEFNVRNN----EGIS 329
            ..|.|.|.:.:.:.|.::..:..:.:.|..:|:..|..:...|..|.|:...|:.||    :| .
Zfish   335 NRIADEGGQALAQALIKNKTLVNLHLGGNNMTEPAAVALSQALVENCALKSLNLCNNRLGADG-G 398

  Fly   330 KFLQRSI-HD--RLGC---LPEEKQEPEYDLSCVNGLQSLPKNK 367
            |.|:..: |:  .:.|   |.:..|:.||.: |    |:|..|:
Zfish   399 KVLEEGMTHNCTLVECDIRLTDVDQDSEYSI-C----QALHANQ 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7886NP_650378.1 LRR_RI <142..320 CDD:238064 39/179 (22%)
leucine-rich repeat 153..180 CDD:275381 6/26 (23%)
leucine-rich repeat 181..208 CDD:275381 8/26 (31%)
leucine-rich repeat 209..246 CDD:275381 6/38 (16%)
leucine-rich repeat 260..285 CDD:275381 6/24 (25%)
tcte1XP_009293283.1 LRR_RI 142..441 CDD:238064 55/239 (23%)
leucine-rich repeat 272..298 CDD:275380 10/28 (36%)
leucine-rich repeat 299..322 CDD:275380 5/22 (23%)
leucine-rich repeat 327..354 CDD:275380 6/30 (20%)
leucine-rich repeat 355..382 CDD:275380 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.