DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad88C and CDHR1

DIOPT Version :9

Sequence 1:NP_731930.3 Gene:Cad88C / 41774 FlyBaseID:FBgn0038247 Length:1981 Species:Drosophila melanogaster
Sequence 2:XP_011538639.1 Gene:CDHR1 / 92211 HGNCID:14550 Length:917 Species:Homo sapiens


Alignment Length:908 Identity:256/908 - (28%)
Similarity:405/908 - (44%) Gaps:192/908 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SNRPPRFAID--GQSEIVLRLKESPE-TKVGTLIYTLKGYDPDNDPLTFGKRNSHDS------EI 110
            :|..|.|..:  |.:...:.|...|| |.||:.:|||.|.||:.||:::     |.|      .:
Human    79 ANFAPHFFDNGVGSTNGNMALFSLPEDTPVGSHVYTLNGTDPEGDPISY-----HISFDPSTRSV 138

  Fly   111 IRIENTGGNEAKIFLAKELDRELQDEYAIVLTLTDSHYSDHNYVTQSFLLLVEDINDNVPTFL-- 173
            ..::.|.||   |.|.:|||||.:||...:::::|.    .|.|.:..::||.|.||..|.|:  
Human   139 FSVDPTFGN---ITLVEELDREREDEIEAIISISDG----LNLVAEKVVILVTDANDEAPRFIQE 196

  Fly   174 PYQNAI--EIPEGSAPGVVSTLEATDADEGAYGQVVYYLQELDGDNDVFSIATHQGKGILRLQ-- 234
            ||...:  :||.||   ::..:.|.|.|.|:.|.|.|:||.|   :..|::..|  .|:||||  
Human   197 PYVALVPEDIPAGS---IIFKVHAVDRDTGSGGSVTYFLQNL---HSPFAVDRH--SGVLRLQAG 253

  Fly   235 KELDYERKSLYQLRVLAIDRANQ----GPINTGTAAILVKVKDLEDQPPEFVEVQAVARIAEDAP 295
            ..|||||...:.:.|:|.|...:    ..:.:.|..:.|.|:|::|..|.||.......:.||..
Human   254 ATLDYERSRTHYITVVAKDGGGRLHGADVVFSATTTVTVNVEDVQDMAPVFVGTPYYGYVYEDTL 318

  Fly   296 VGTKVLRVRAIDGDRGINNPIAYSL-EAND-LFDINPHTG---IVHTLTKLDREEQSDQVNGAHI 355
            .|::||:|.|:|||||..|.|.||| ..|| .|:||..:|   |..:..:|.||        .:.
Human   319 PGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEINETSGAISITQSPAQLQRE--------VYE 375

  Fly   356 LRISATELSKSNTQMAPTTVRTEVTVIVSDVNDEIPTF-GET--VYRCEVNENAQTNTPLNFIDE 417
            |.:..||:|.:.:..|..||  .||:.:.|:|:..||| ||:  ..|.|::.|  .:.|...|..
Human   376 LHVQVTEMSPAGSPAAQATV--PVTIRIVDLNNHPPTFYGESGPQNRFELSMN--EHPPQGEILR 436

  Fly   418 EVQNVVFDHDEGNNGTFRLFLDPPNDLFEIVPELAVNEANFMLRVKNSKSLDFEQFTEVNFTIFA 482
            .::..|.|.|:|.|..|.|.|..|..:|.:||:..:|||...:.|:||.::|||:...:.|.:.|
Human   437 GLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKVLTFKLLA 501

  Fly   483 REVDEPSRWSS-AHVQIFIRDQNDNFPEFSQTIYNASVLENSEQDTIITHVQAVDVDSGDYGTMG 546
            .||:.|.::|| |.|.|.:.|.|||.|:|....|.|.:.||:...:.:..|.|||.|:|.:|.  
Human   502 VEVNTPEKFSSTADVVIQLLDTNDNVPKFDSLYYVARIPENAPGGSSVVAVTAVDPDTGPWGE-- 564

  Fly   547 IRYTNLRGGIAHLLNLNPITGVITIKQAGGTAFDREIISRHYLTVEAIDNAGQGNRNTAQIIVDI 611
            ::|:....| |.|..::|.||:|..:.  ..:.|.|..:|:...|:|.|.  :|..:.|::.:.:
Human   565 VKYSTYGTG-ADLFLIHPSTGLIYTQP--WASLDAEATARYNFYVKAEDM--EGKYSVAEVFITL 624

  Fly   612 LDVNDNAPTFPQR-QYETKLLENQAEFETPLQLEARDADLNGTENSQVTYEIVEGLYRSNFTIDP 675
            |||||:.|.|.:. |.:|.:|      .||:::||.|.|.. ..|:.|.|.|...          
Human   625 LDVNDHPPQFGKSVQKKTMVL------GTPVKIEAIDEDAE-EPNNLVDYSITHA---------- 672

  Fly   676 QSGLLRPVHSFDFEELVDGSSRRSDPYTGGSF---SIREIDLL--------------VRARDSGI 723
                 .|.:.||.           :.:||..:   |||.:|.|              |:|:|.|.
Human   673 -----EPANVFDI-----------NSHTGEIWLKNSIRSLDALHNITPGRDCLWSLEVQAKDRGS 721

  Fly   724 PMLSTVVPVLIYVQDVNDNAPIFQQSFYAKTVPEDLPGGSSVLQVTAIDRDGSAPNNVVVYRIQT 788
            |..||                                  :::|::...|.:..:.:.:..:.|||
Human   722 PSFST----------------------------------TALLKIDITDAETLSRSPMAAFLIQT 752

  Fly   789 GAGDKFIINSETGVISVAHGANLDPDLTESKRSLYTLSVIALDGGLGNSQLMTTCTVNISIQDVN 853
                                         ....:..:.|:|     |....:...||.||.....
Human   753 -----------------------------KDNPMKAVGVLA-----GTMATVVAITVLISTATFW 783

  Fly   854 NKPPVLKEMPALQILENTP-VGTLVYRIQ-----ATDLDHKAILRYKLNPEHCEGRTEEGALV 910
            ......|.:|..::|...| ......||:     :|....|.:|:.|...|:|...:.|.:|:
Human   784 RNKKSNKVLPMRRVLRKRPSPAPRTIRIEWLKSKSTKAATKFMLKEKPPNENCNNNSPESSLL 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad88CNP_731930.3 Cadherin_repeat 76..168 CDD:206637 34/98 (35%)
Cadherin_repeat 179..276 CDD:206637 33/104 (32%)
Cadherin_repeat 287..388 CDD:206637 37/105 (35%)
Cadherin_repeat 397..506 CDD:206637 38/109 (35%)
Cadherin_repeat 514..617 CDD:206637 31/102 (30%)
Cadherin_repeat 625..742 CDD:206637 30/133 (23%)
Cadherin_repeat 751..853 CDD:206637 12/101 (12%)
Cadherin_repeat 865..976 CDD:206637 12/52 (23%)
Cadherin_repeat 985..1080 CDD:206637
Cadherin_repeat 1090..1191 CDD:206637
CA 1221..1302 CDD:214520
Cadherin_repeat 1312..1409 CDD:206637
Cadherin_repeat 1418..>1502 CDD:206637
Cadherin_repeat 1617..1710 CDD:206637
CDHR1XP_011538639.1 Cadherin_repeat 100..188 CDD:206637 33/99 (33%)
Cadherin_repeat 197..299 CDD:206637 35/109 (32%)
Cadherin_repeat 308..407 CDD:206637 38/108 (35%)
Cadherin_repeat 421..526 CDD:206637 37/106 (35%)
Cadherin_repeat 535..630 CDD:206637 31/101 (31%)
Cadherin_repeat 646..737 CDD:206637 28/151 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9086
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24028
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.