DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad88C and Cdhr4

DIOPT Version :9

Sequence 1:NP_731930.3 Gene:Cad88C / 41774 FlyBaseID:FBgn0038247 Length:1981 Species:Drosophila melanogaster
Sequence 2:NP_001365320.1 Gene:Cdhr4 / 69398 MGIID:1916648 Length:783 Species:Mus musculus


Alignment Length:687 Identity:158/687 - (22%)
Similarity:251/687 - (36%) Gaps:179/687 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   857 PVLKEMP-ALQILENTPVGTLVYRIQATDLDHKAILR--------YKLNPEHCEGRTEEGALVKS 912
            |||..:| .:.|.||...||              :||        |....|....|.......|.
Mouse    16 PVLYSLPWTMYISENNGPGT--------------VLRPFSFNCSSYMPTLELLSVRPPTSFFNKP 66

  Fly   913 SEYDFLGAFEVDSIEGTLKVVKLLDRERVEHIKLAITVEDLAAAK--GRQIAEGFLSIQVLDEND 975
            |.:...|.:        |.:|.|....|::  .||:...:|....  |..:.:|.:.:.|..:..
Mouse    67 SMHGDKGVY--------LVMVSLSSSARLD--ALAVNQYELQLQYRCGNFVVDGSIFVHVQRDPG 121

  Fly   976 N--------NPKFRLPFYRQSITENSINGAMIVNVLASDVDKNR-TITYALEGNPTYRSL----M 1027
            .        :|.....:..::||.    ||::..:|...|.:.: .||.|...:|...|:    :
Mouse   122 RIRCTGAFASPAGEFIYVPETITP----GALVYTLLLPGVQRAQINITSAQNPSPGPFSIDEQGL 182

  Fly  1028 HLDPQTGEIVVASK-------IDHEQHQWLNFSVRA--TDSGIPARSSLVDVYITVLDENDNNPY 1083
            ...|..|....|.|       :..|::|    |.|.  |...:||.||.|.              
Mouse   183 LRAPSQGLRGQAQKTFQLQISVSFEKNQ----SCRGMLTVKVLPAPSSQVS-------------- 229

  Fly  1084 FVGGSKNYTISENAAPGTRVATLQAGDADSGDFGKITFLMDRISSQGK--FTIDADTGVLTVADR 1146
            |:..:::.||||:..||:.|..:||    :|    ...|.:.||.:..  ::|....||:.....
Mouse   230 FLQKAQSITISEDLVPGSEVVRVQA----TG----FNLLYEIISPRPSLFYSIGQADGVVRTTAP 286

  Fly  1147 LDR---ESKDSYNLVIEAWDNYQFGFLAGESRNAFKQVF---ISILDENDNPPEVDLPMSCVLIT 1205
            ||.   :......|.:.|::         ..|.....||   :|:...|..||...   ..:|:|
Mouse   287 LDLARVQGAMVTKLQVRAFE---------RPRPWASAVFDLTVSVRAVNQWPPRCH---PALLVT 339

  Fly  1206 EYHELHERVASIVGKDAD-----DPTTPNGRLDFAITRGNKDGMFELRQIDAWNAQIFASKSLRN 1265
            :..|     .|:||...|     ||.:....||:              |:...:....||..||:
Mouse   340 QIPE-----TSLVGTVLDALTCVDPDSAGRPLDY--------------QLRFHSPPDSASLRLRD 385

  Fly  1266 RY---------------GNYSLTITTRDMGLPANIVHNTLDICVSDFNDHAPVFVRPLHNTTVRI 1315
            |.               ..:|.:|...|.|.|.......:.:.|:..|:.:|..|    ..|.|:
Mouse   386 RILEVNATLDCDTPGACFQHSASILVVDGGQPQMTTEIPVLVMVTPVNEFSPACV----PRTFRV 446

  Fly  1316 PENATVGTLILQAYASDGDMGQNALVRYRLKPDPLGSYKMFEVDGSTGELFLKEQLNREKQKIHE 1380
            .|:....||:.....:|.|..:|:| .|.:...|    ..|.||..:|||.|...|:.|:|::::
Mouse   447 QEDTGPHTLLGSIVGTDMDYPRNSL-EYYISGGP----STFAVDRLSGELHLLGPLDYEQQRLYK 506

  Fly  1381 IRI----EAYDQGLPTSLSSDLDLTIYVRNVNDY----EPQFMVNEISVNFTE--HSDPGSERIK 1435
            |.|    .:.|..|.:..|....:||.|.:|||:    ||.|  .|::: :|.  ||   .|..|
Mouse   507 ITILLIDHSQDWDLNSHRSGSCTITIEVEDVNDHAPECEPPF--QELTI-YTPMGHS---MEVTK 565

  Fly  1436 LPDTIDKDQLELDDPNDTPSQVCYFIVNGNEAGYFRL 1472
            :...|.::...|        .:.|.||.||....|||
Mouse   566 VSCWIPQEPQRL--------TLSYSIVGGNSQSRFRL 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad88CNP_731930.3 Cadherin_repeat 76..168 CDD:206637
Cadherin_repeat 179..276 CDD:206637
Cadherin_repeat 287..388 CDD:206637
Cadherin_repeat 397..506 CDD:206637
Cadherin_repeat 514..617 CDD:206637
Cadherin_repeat 625..742 CDD:206637
Cadherin_repeat 751..853 CDD:206637
Cadherin_repeat 865..976 CDD:206637 23/120 (19%)
Cadherin_repeat 985..1080 CDD:206637 25/108 (23%)
Cadherin_repeat 1090..1191 CDD:206637 25/108 (23%)
CA 1221..1302 CDD:214520 18/100 (18%)
Cadherin_repeat 1312..1409 CDD:206637 30/100 (30%)
Cadherin_repeat 1418..>1502 CDD:206637 16/57 (28%)
Cadherin_repeat 1617..1710 CDD:206637
Cdhr4NP_001365320.1 Cadherin_repeat 236..326 CDD:206637 24/106 (23%)
Cadherin_repeat 338..434 CDD:206637 22/114 (19%)
Cadherin_repeat 441..540 CDD:206637 31/103 (30%)
Cadherin_repeat 555..644 CDD:206637 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24028
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.